BLASTX nr result
ID: Atractylodes22_contig00053742
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00053742 (219 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002867934.1| hypothetical protein ARALYDRAFT_354804 [Arab... 55 8e-06 >ref|XP_002867934.1| hypothetical protein ARALYDRAFT_354804 [Arabidopsis lyrata subsp. lyrata] gi|297313770|gb|EFH44193.1| hypothetical protein ARALYDRAFT_354804 [Arabidopsis lyrata subsp. lyrata] Length = 686 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/61 (40%), Positives = 38/61 (62%), Gaps = 1/61 (1%) Frame = -3 Query: 214 WFSNQSMGDCLKVELPPDWCYEKFKGIALCLVFTPRNPNGRKSSYGSI-GYRFKNFDGTS 38 WF +Q MG ++ LPP WC +KF G++LC+V + ++ R S + I +F+N DG S Sbjct: 467 WFRHQRMGSSMETHLPPHWCDDKFIGLSLCIVVSFKDYEDRTSRFSVICKCKFRNEDGNS 526 Query: 37 I 35 I Sbjct: 527 I 527