BLASTX nr result
ID: Atractylodes22_contig00053731
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00053731 (338 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514759.1| conserved hypothetical protein [Ricinus comm... 55 4e-06 >ref|XP_002514759.1| conserved hypothetical protein [Ricinus communis] gi|223546363|gb|EEF47865.1| conserved hypothetical protein [Ricinus communis] Length = 126 Score = 55.5 bits (132), Expect = 4e-06 Identities = 35/81 (43%), Positives = 47/81 (58%), Gaps = 13/81 (16%) Frame = +2 Query: 134 NMGTANCRLMILVICIVFLSLQSQRVSALRSIDLAWR------------RVLDVEELDK- 274 NMG R +L++CI +LS Q ++VS+L SIDLA R R+L LD Sbjct: 32 NMGFLVHRGFLLLLCIGYLSFQPEKVSSLTSIDLALRLKQELLPVAQNSRMLTTVALDDL 91 Query: 275 QLNTAPTPTPSVMFDPNESNK 337 Q T+ P PS++FDPN+SNK Sbjct: 92 QTFTSSAPAPSMVFDPNQSNK 112