BLASTX nr result
ID: Atractylodes22_contig00053670
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00053670 (294 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002321224.1| predicted protein [Populus trichocarpa] gi|2... 61 8e-08 ref|XP_002524574.1| auxilin, putative [Ricinus communis] gi|2235... 56 3e-06 >ref|XP_002321224.1| predicted protein [Populus trichocarpa] gi|222861997|gb|EEE99539.1| predicted protein [Populus trichocarpa] Length = 941 Score = 61.2 bits (147), Expect = 8e-08 Identities = 33/68 (48%), Positives = 39/68 (57%) Frame = -3 Query: 205 IFNDVFGGPPKYXXXXXXXXXXXSDFDYDSIFKDSVSANNNEAKTKPTSSNSPVYDKPLY 26 +FN+ F GP KY S FDYDSIFKD S S++ PV+DKP+Y Sbjct: 68 LFNNAFDGPLKYSESRGGASTTTSSFDYDSIFKDQNSK----------SASLPVFDKPVY 117 Query: 25 DDDIFDGL 2 DDDIFDGL Sbjct: 118 DDDIFDGL 125 >ref|XP_002524574.1| auxilin, putative [Ricinus communis] gi|223536127|gb|EEF37782.1| auxilin, putative [Ricinus communis] Length = 983 Score = 56.2 bits (134), Expect = 3e-06 Identities = 33/69 (47%), Positives = 39/69 (56%), Gaps = 2/69 (2%) Frame = -3 Query: 202 FNDVFGGPPKYXXXXXXXXXXXSDFDYDSIFKDSVSANNNEAKTKPTSSNSPVYDKPLY- 26 F+DVFGGPPK FDYDS+FKD S +S+ PV+DKP+Y Sbjct: 75 FSDVFGGPPK------------RSFDYDSVFKDQQSK----------TSSLPVFDKPVYD 112 Query: 25 -DDDIFDGL 2 DDDIFDGL Sbjct: 113 DDDDIFDGL 121