BLASTX nr result
ID: Atractylodes22_contig00053594
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00053594 (265 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003529413.1| PREDICTED: uncharacterized protein LOC100786... 59 3e-07 ref|XP_002307264.1| predicted protein [Populus trichocarpa] gi|2... 59 5e-07 ref|XP_002883905.1| hypothetical protein ARALYDRAFT_343146 [Arab... 58 7e-07 ref|XP_003611749.1| hypothetical protein MTR_5g017450 [Medicago ... 57 2e-06 ref|XP_002523579.1| conserved hypothetical protein [Ricinus comm... 57 2e-06 >ref|XP_003529413.1| PREDICTED: uncharacterized protein LOC100786207 [Glycine max] Length = 170 Score = 59.3 bits (142), Expect = 3e-07 Identities = 32/57 (56%), Positives = 40/57 (70%), Gaps = 6/57 (10%) Frame = +3 Query: 111 LYKQKSLSTDFYREEAWLRRKDNQHH----HHR--HRRTKSLITTEDIDELKGCLDL 263 LYKQ+S S D R+EAW RRKDN HH +HR HR +KSL + +D+DELK C +L Sbjct: 17 LYKQQSWSPDTLRDEAWQRRKDNSHHISGDNHRCSHRLSKSL-SEDDLDELKACFEL 72 >ref|XP_002307264.1| predicted protein [Populus trichocarpa] gi|222856713|gb|EEE94260.1| predicted protein [Populus trichocarpa] Length = 177 Score = 58.5 bits (140), Expect = 5e-07 Identities = 29/51 (56%), Positives = 38/51 (74%) Frame = +3 Query: 111 LYKQKSLSTDFYREEAWLRRKDNQHHHHRHRRTKSLITTEDIDELKGCLDL 263 LYKQ S S D YR+EAWLRRK N ++ ++ KS +T ED+DELKGC++L Sbjct: 37 LYKQHSWSPDIYRDEAWLRRKGN----YKKKKCKS-VTDEDLDELKGCIEL 82 >ref|XP_002883905.1| hypothetical protein ARALYDRAFT_343146 [Arabidopsis lyrata subsp. lyrata] gi|297329745|gb|EFH60164.1| hypothetical protein ARALYDRAFT_343146 [Arabidopsis lyrata subsp. lyrata] Length = 151 Score = 58.2 bits (139), Expect = 7e-07 Identities = 30/51 (58%), Positives = 36/51 (70%) Frame = +3 Query: 111 LYKQKSLSTDFYREEAWLRRKDNQHHHHRHRRTKSLITTEDIDELKGCLDL 263 L KQ+SL D REEAWLR K +H R RR+KS T++DI+ELKGC DL Sbjct: 13 LMKQQSLPLDVNREEAWLRMK-KRHPSDRLRRSKSCFTSDDIEELKGCFDL 62 >ref|XP_003611749.1| hypothetical protein MTR_5g017450 [Medicago truncatula] gi|355513084|gb|AES94707.1| hypothetical protein MTR_5g017450 [Medicago truncatula] Length = 172 Score = 57.0 bits (136), Expect = 2e-06 Identities = 29/51 (56%), Positives = 38/51 (74%) Frame = +3 Query: 111 LYKQKSLSTDFYREEAWLRRKDNQHHHHRHRRTKSLITTEDIDELKGCLDL 263 L KQ+S S D YR+EAWLRRK N ++RR+KS +T ED+DELK C++L Sbjct: 30 LLKQRSWSPDLYRDEAWLRRKGN----WKNRRSKS-VTDEDVDELKACIEL 75 >ref|XP_002523579.1| conserved hypothetical protein [Ricinus communis] gi|223537141|gb|EEF38774.1| conserved hypothetical protein [Ricinus communis] Length = 300 Score = 56.6 bits (135), Expect = 2e-06 Identities = 28/51 (54%), Positives = 37/51 (72%) Frame = +3 Query: 111 LYKQKSLSTDFYREEAWLRRKDNQHHHHRHRRTKSLITTEDIDELKGCLDL 263 LYKQ S S D YR+EAWLRRK N + +++KS +T ED+DELK C++L Sbjct: 159 LYKQHSWSPDIYRDEAWLRRKGNS----KKKKSKS-VTDEDVDELKACIEL 204