BLASTX nr result
ID: Atractylodes22_contig00053501
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00053501 (252 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI35917.3| unnamed protein product [Vitis vinifera] 84 1e-14 gb|EIE22455.1| S-adenosyl-L-methionine-dependent methyltransfera... 64 1e-08 ref|NP_850075.2| S-adenosyl-L-methionine-dependent methyltransfe... 62 4e-08 ref|XP_002308544.1| predicted protein [Populus trichocarpa] gi|2... 62 5e-08 gb|ABK25486.1| unknown [Picea sitchensis] 62 5e-08 >emb|CBI35917.3| unnamed protein product [Vitis vinifera] Length = 288 Score = 84.0 bits (206), Expect = 1e-14 Identities = 38/52 (73%), Positives = 44/52 (84%) Frame = +1 Query: 4 DGTSSFYFSEDLLSKLFVRAGFTVVDVNTYNREIKNRSRNITMQRRWIRAVF 159 DGT SFYFSED LS LF RAGFT VDVN Y ++I+NRS+N+TM RRWIRA+F Sbjct: 224 DGTCSFYFSEDFLSNLFSRAGFTTVDVNIYCKQIENRSQNVTMNRRWIRAIF 275 >gb|EIE22455.1| S-adenosyl-L-methionine-dependent methyltransferase [Coccomyxa subellipsoidea C-169] Length = 486 Score = 63.9 bits (154), Expect = 1e-08 Identities = 27/53 (50%), Positives = 42/53 (79%) Frame = +1 Query: 1 GDGTSSFYFSEDLLSKLFVRAGFTVVDVNTYNREIKNRSRNITMQRRWIRAVF 159 GDGT +FYFSE+ L +LF R G+ +D++ + R+++NR++ I M+RRWI+AVF Sbjct: 197 GDGTRAFYFSEEGLLELFRRNGYRCMDMHVHERQVENRAKAIVMERRWIQAVF 249 >ref|NP_850075.2| S-adenosyl-L-methionine-dependent methyltransferase domain-containing protein [Arabidopsis thaliana] gi|20197178|gb|AAC14529.2| hypothetical protein [Arabidopsis thaliana] gi|330252713|gb|AEC07807.1| S-adenosyl-L-methionine-dependent methyltransferase domain-containing protein [Arabidopsis thaliana] Length = 565 Score = 62.4 bits (150), Expect = 4e-08 Identities = 26/55 (47%), Positives = 38/55 (69%) Frame = +1 Query: 1 GDGTSSFYFSEDLLSKLFVRAGFTVVDVNTYNREIKNRSRNITMQRRWIRAVFRR 165 GDGT +FYFS + L LF GF V +++ ++++NRSR + M RRW++A FRR Sbjct: 210 GDGTRAFYFSNEFLETLFSEQGFEVEELDVCCKQVENRSRELVMNRRWVQATFRR 264 >ref|XP_002308544.1| predicted protein [Populus trichocarpa] gi|222854520|gb|EEE92067.1| predicted protein [Populus trichocarpa] Length = 557 Score = 62.0 bits (149), Expect = 5e-08 Identities = 28/54 (51%), Positives = 38/54 (70%) Frame = +1 Query: 1 GDGTSSFYFSEDLLSKLFVRAGFTVVDVNTYNREIKNRSRNITMQRRWIRAVFR 162 GDGT +FYFS + L+ LF GF V ++ ++++NRSR I M RRWI+AVFR Sbjct: 206 GDGTRAFYFSNEFLTSLFKDNGFDVEELGLCCKQVENRSREIVMNRRWIQAVFR 259 >gb|ABK25486.1| unknown [Picea sitchensis] Length = 611 Score = 62.0 bits (149), Expect = 5e-08 Identities = 27/53 (50%), Positives = 36/53 (67%) Frame = +1 Query: 1 GDGTSSFYFSEDLLSKLFVRAGFTVVDVNTYNREIKNRSRNITMQRRWIRAVF 159 GDGT +FYFSE+ L+ LF R GFT V + + ++NRSR + M RRWI+ F Sbjct: 258 GDGTRAFYFSEEALTSLFTRNGFTSEKVGVHYKRVENRSRGLVMDRRWIQGEF 310