BLASTX nr result
ID: Atractylodes22_contig00053471
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00053471 (295 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002529027.1| glycerophosphoryl diester phosphodiesterase,... 59 5e-07 ref|NP_176870.2| suppressor of npr1-1 constitutive 4 [Arabidopsi... 57 2e-06 gb|AAF98210.1|AC007152_6 Unknown protein [Arabidopsis thaliana] 57 2e-06 >ref|XP_002529027.1| glycerophosphoryl diester phosphodiesterase, putative [Ricinus communis] gi|223531507|gb|EEF33338.1| glycerophosphoryl diester phosphodiesterase, putative [Ricinus communis] Length = 768 Score = 58.5 bits (140), Expect = 5e-07 Identities = 27/52 (51%), Positives = 34/52 (65%) Frame = +3 Query: 3 PATAARYRRSKCLQLPADKVPTYAVPVRPGELLTTTQRQSMPPAPPPNPVLT 158 P TAARY+R+KCL + + P Y PV+PG LL + +PPA PNPVLT Sbjct: 660 PKTAARYKRNKCLNM-GNSTPAYMAPVQPGSLLQLITQDYLPPAEAPNPVLT 710 >ref|NP_176870.2| suppressor of npr1-1 constitutive 4 [Arabidopsis thaliana] gi|298239801|gb|ADI71282.1| SNC4 [Arabidopsis thaliana] gi|332196460|gb|AEE34581.1| suppressor of npr1-1 constitutive 4 [Arabidopsis thaliana] Length = 1118 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/52 (50%), Positives = 35/52 (67%) Frame = +3 Query: 3 PATAARYRRSKCLQLPADKVPTYAVPVRPGELLTTTQRQSMPPAPPPNPVLT 158 P TAARY+R++CL ++VP Y +PV PG +LT S+PPA PNP+ T Sbjct: 663 PYTAARYKRNRCLG--REEVPPYMLPVNPGGVLTLISTSSLPPAQDPNPIFT 712 >gb|AAF98210.1|AC007152_6 Unknown protein [Arabidopsis thaliana] Length = 1111 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/52 (50%), Positives = 35/52 (67%) Frame = +3 Query: 3 PATAARYRRSKCLQLPADKVPTYAVPVRPGELLTTTQRQSMPPAPPPNPVLT 158 P TAARY+R++CL ++VP Y +PV PG +LT S+PPA PNP+ T Sbjct: 665 PYTAARYKRNRCLG--REEVPPYMLPVNPGGVLTLISTSSLPPAQDPNPIFT 714