BLASTX nr result
ID: Atractylodes22_contig00053322
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00053322 (364 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514736.1| NAC domain-containing protein 21/22, putativ... 85 5e-15 ref|XP_002284825.1| PREDICTED: NAC domain-containing protein 100... 84 9e-15 ref|XP_002866435.1| ANAC100/ATNAC5 [Arabidopsis lyrata subsp. ly... 82 4e-14 ref|NP_200951.1| NAC domain containing protein 100 [Arabidopsis ... 82 4e-14 ref|XP_002318383.1| NAC domain protein, IPR003441 [Populus trich... 82 6e-14 >ref|XP_002514736.1| NAC domain-containing protein 21/22, putative [Ricinus communis] gi|223546340|gb|EEF47842.1| NAC domain-containing protein 21/22, putative [Ricinus communis] Length = 361 Score = 85.1 bits (209), Expect = 5e-15 Identities = 37/51 (72%), Positives = 46/51 (90%) Frame = -1 Query: 154 NLSGFLKEDDPMNLPPGFRFHPTDEELITHYLSNKVVDCNFSARAIGEVDM 2 N+SG +KEDD M+LPPGFRFHPTDEELI+HYL KV+D +FS+RAIG+VD+ Sbjct: 3 NISGLVKEDDQMDLPPGFRFHPTDEELISHYLYKKVLDISFSSRAIGDVDL 53 >ref|XP_002284825.1| PREDICTED: NAC domain-containing protein 100 isoform 1 [Vitis vinifera] gi|147810455|emb|CAN69806.1| hypothetical protein VITISV_019654 [Vitis vinifera] Length = 360 Score = 84.3 bits (207), Expect = 9e-15 Identities = 38/51 (74%), Positives = 44/51 (86%) Frame = -1 Query: 154 NLSGFLKEDDPMNLPPGFRFHPTDEELITHYLSNKVVDCNFSARAIGEVDM 2 N++G EDD M LPPGFRFHPTDEELITHYLS KV+D NFSARAIG+V++ Sbjct: 3 NIAGLSVEDDQMILPPGFRFHPTDEELITHYLSKKVIDSNFSARAIGQVNL 53 >ref|XP_002866435.1| ANAC100/ATNAC5 [Arabidopsis lyrata subsp. lyrata] gi|297312270|gb|EFH42694.1| ANAC100/ATNAC5 [Arabidopsis lyrata subsp. lyrata] Length = 336 Score = 82.0 bits (201), Expect = 4e-14 Identities = 39/55 (70%), Positives = 46/55 (83%) Frame = -1 Query: 166 MEDFNLSGFLKEDDPMNLPPGFRFHPTDEELITHYLSNKVVDCNFSARAIGEVDM 2 ME F GF KE++ M+LPPGFRFHPTDEELITHYL KV+D +FSA+AIGEVD+ Sbjct: 1 METF--CGFQKEEEQMDLPPGFRFHPTDEELITHYLHKKVLDISFSAKAIGEVDL 53 >ref|NP_200951.1| NAC domain containing protein 100 [Arabidopsis thaliana] gi|75171471|sp|Q9FLJ2.1|NC100_ARATH RecName: Full=NAC domain-containing protein 100; Short=ANAC100; Short=AtNAC5 gi|9757865|dbj|BAB08499.1| NAM (no apical meristem)-like protein [Arabidopsis thaliana] gi|15451128|gb|AAK96835.1| NAM (no apical meristem)-like protein [Arabidopsis thaliana] gi|20148335|gb|AAM10058.1| NAM (no apical meristem)-like protein [Arabidopsis thaliana] gi|332010085|gb|AED97468.1| NAC domain containing protein 100 [Arabidopsis thaliana] Length = 336 Score = 82.0 bits (201), Expect = 4e-14 Identities = 39/55 (70%), Positives = 46/55 (83%) Frame = -1 Query: 166 MEDFNLSGFLKEDDPMNLPPGFRFHPTDEELITHYLSNKVVDCNFSARAIGEVDM 2 ME F GF KE++ M+LPPGFRFHPTDEELITHYL KV+D +FSA+AIGEVD+ Sbjct: 1 METF--CGFQKEEEQMDLPPGFRFHPTDEELITHYLHKKVLDTSFSAKAIGEVDL 53 >ref|XP_002318383.1| NAC domain protein, IPR003441 [Populus trichocarpa] gi|222859056|gb|EEE96603.1| NAC domain protein, IPR003441 [Populus trichocarpa] Length = 359 Score = 81.6 bits (200), Expect = 6e-14 Identities = 39/52 (75%), Positives = 45/52 (86%), Gaps = 1/52 (1%) Frame = -1 Query: 154 NLSGFLKEDDP-MNLPPGFRFHPTDEELITHYLSNKVVDCNFSARAIGEVDM 2 N+SG KEDD M+LPPGFRFHPTDEELI+HYL KV+D NFSARAIG+VD+ Sbjct: 3 NISGLGKEDDDKMDLPPGFRFHPTDEELISHYLYKKVLDINFSARAIGDVDL 54