BLASTX nr result
ID: Atractylodes22_contig00053135
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00053135 (274 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003533416.1| PREDICTED: dehydrodolichyl diphosphate synth... 55 5e-06 >ref|XP_003533416.1| PREDICTED: dehydrodolichyl diphosphate synthase 6-like [Glycine max] Length = 308 Score = 55.5 bits (132), Expect = 5e-06 Identities = 27/48 (56%), Positives = 36/48 (75%), Gaps = 1/48 (2%) Frame = +2 Query: 134 ERTSG-VIGRFLGSLNSTMRRFLFHVVSSDPMTPHIAFIMDGNRRFAK 274 ++TSG +IG FLG L +RR +F ++S P+ HIAFIMDGNRR+AK Sbjct: 2 QKTSGNIIGHFLGGLYYYLRRCMFAILSVGPVPSHIAFIMDGNRRYAK 49