BLASTX nr result
ID: Atractylodes22_contig00053120
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00053120 (300 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002315110.1| predicted protein [Populus trichocarpa] gi|2... 57 2e-06 emb|CAN67346.1| hypothetical protein VITISV_030338 [Vitis vinifera] 57 2e-06 ref|XP_004155090.1| PREDICTED: LETM1 and EF-hand domain-containi... 57 2e-06 ref|XP_004152837.1| PREDICTED: LETM1 and EF-hand domain-containi... 57 2e-06 ref|XP_002309727.1| predicted protein [Populus trichocarpa] gi|2... 57 2e-06 >ref|XP_002315110.1| predicted protein [Populus trichocarpa] gi|222864150|gb|EEF01281.1| predicted protein [Populus trichocarpa] Length = 658 Score = 57.0 bits (136), Expect = 2e-06 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +3 Query: 3 FLLPVFLKLFPNMLPSTFQDKMKEQVLVQTVLN 101 FLLPVFLKLFPNMLPSTFQDKMKEQ ++ LN Sbjct: 182 FLLPVFLKLFPNMLPSTFQDKMKEQEALKRKLN 214 >emb|CAN67346.1| hypothetical protein VITISV_030338 [Vitis vinifera] Length = 480 Score = 57.0 bits (136), Expect = 2e-06 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +3 Query: 3 FLLPVFLKLFPNMLPSTFQDKMKEQVLVQTVLN 101 FLLPVFLKLFPNMLPSTFQDKMKEQ ++ LN Sbjct: 280 FLLPVFLKLFPNMLPSTFQDKMKEQEALKRKLN 312 >ref|XP_004155090.1| PREDICTED: LETM1 and EF-hand domain-containing protein 1, mitochondrial-like [Cucumis sativus] Length = 756 Score = 56.6 bits (135), Expect = 2e-06 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +3 Query: 3 FLLPVFLKLFPNMLPSTFQDKMKEQVLVQTVLN 101 FLLPVFLKLFPNMLPSTFQDKMKEQ ++ LN Sbjct: 278 FLLPVFLKLFPNMLPSTFQDKMKEQEALKRRLN 310 >ref|XP_004152837.1| PREDICTED: LETM1 and EF-hand domain-containing protein 1, mitochondrial-like [Cucumis sativus] Length = 746 Score = 56.6 bits (135), Expect = 2e-06 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +3 Query: 3 FLLPVFLKLFPNMLPSTFQDKMKEQVLVQTVLN 101 FLLPVFLKLFPNMLPSTFQDKMKEQ ++ LN Sbjct: 278 FLLPVFLKLFPNMLPSTFQDKMKEQEALKRRLN 310 >ref|XP_002309727.1| predicted protein [Populus trichocarpa] gi|222852630|gb|EEE90177.1| predicted protein [Populus trichocarpa] Length = 750 Score = 56.6 bits (135), Expect = 2e-06 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +3 Query: 3 FLLPVFLKLFPNMLPSTFQDKMKEQVLVQTVLN 101 FLLPVFLKLFPNMLPSTFQDKMKEQ ++ LN Sbjct: 271 FLLPVFLKLFPNMLPSTFQDKMKEQEALKRRLN 303