BLASTX nr result
ID: Atractylodes22_contig00053084
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00053084 (680 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAG43550.1|AF211532_1 Avr9/Cf-9 rapidly elicited protein 132 ... 59 9e-07 >gb|AAG43550.1|AF211532_1 Avr9/Cf-9 rapidly elicited protein 132 [Nicotiana tabacum] Length = 256 Score = 58.9 bits (141), Expect = 9e-07 Identities = 38/98 (38%), Positives = 47/98 (47%), Gaps = 4/98 (4%) Frame = +2 Query: 398 DSYMVELAGKXXXXXXXXXXXXXXXXXXXHLYAKWFCYRLEEDGDRPNTXXXXXG----D 565 +S M+EL K HLY KWF +ED PN + Sbjct: 8 ESGMIELTAKIMMVVIIFLFLVVVFIFFLHLYTKWFWRYRQEDTGNPNGGTRRRRRRRFN 67 Query: 566 FSAGHQEQQSGVTVLRRGLDASFLETIPVILFDPKDFK 679 F+ G+QE V VLRRGLD S L+TIPV+ F+ KDFK Sbjct: 68 FAGGYQE----VNVLRRGLDPSVLKTIPVVPFNMKDFK 101