BLASTX nr result
ID: Atractylodes22_contig00052988
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00052988 (392 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002299334.1| predicted protein [Populus trichocarpa] gi|2... 60 1e-07 >ref|XP_002299334.1| predicted protein [Populus trichocarpa] gi|222846592|gb|EEE84139.1| predicted protein [Populus trichocarpa] Length = 251 Score = 60.5 bits (145), Expect = 1e-07 Identities = 22/40 (55%), Positives = 27/40 (67%) Frame = +3 Query: 24 CNYCHDTSHNLLNCPVRTCKCCNKEHPRHYVNDCYKNPNR 143 CNYC H LL CP+R C+ C+KE P H DC++NPNR Sbjct: 67 CNYCKKPGHILLECPIRVCRFCHKEAPGHLQRDCFQNPNR 106