BLASTX nr result
ID: Atractylodes22_contig00052948
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00052948 (398 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAC95126.1| gag-pol polyprotein [Populus deltoides] 75 6e-12 >emb|CAC95126.1| gag-pol polyprotein [Populus deltoides] Length = 1382 Score = 75.1 bits (183), Expect = 6e-12 Identities = 37/63 (58%), Positives = 45/63 (71%) Frame = +2 Query: 140 DETCLKTQVGKGILPTSTLNPSVLVVTQKSFASQQNIFRTRVGIDKCSFCKEKGHWKSQC 319 +E L++ KGIL S NPSVL V K F++ QN TRVG D+CSFCK+KGHWK+QC Sbjct: 201 EEIRLQSYSEKGILSAS--NPSVLAVPSKPFSNHQNKPYTRVGFDECSFCKQKGHWKAQC 258 Query: 320 PKL 328 PKL Sbjct: 259 PKL 261