BLASTX nr result
ID: Atractylodes22_contig00052588
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00052588 (254 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN70473.1| hypothetical protein VITISV_037490 [Vitis vinifera] 54 7e-11 >emb|CAN70473.1| hypothetical protein VITISV_037490 [Vitis vinifera] Length = 786 Score = 54.3 bits (129), Expect(2) = 7e-11 Identities = 24/37 (64%), Positives = 28/37 (75%) Frame = +2 Query: 11 E*HRILGHPSFPIPKHVALHYQLDLLSSILSNFSCNV 121 E H LGHP FPI KH+ HYQLDL SS++S+F CNV Sbjct: 161 EWHHRLGHPVFPILKHIVSHYQLDLSSSLISDFLCNV 197 Score = 37.4 bits (85), Expect(2) = 7e-11 Identities = 18/41 (43%), Positives = 29/41 (70%) Frame = +3 Query: 117 MCHCNTSQTLPFSTTSLVLTKPLEIIF*CADFLNPIMIALN 239 +CH N + LPFST+++V ++PLEIIF +D ++I+ N Sbjct: 197 VCHYNKNHKLPFSTSTVVSSQPLEIIF--SDVWTSLVISHN 235