BLASTX nr result
ID: Atractylodes22_contig00052504
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00052504 (315 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI22241.3| unnamed protein product [Vitis vinifera] 120 1e-25 ref|XP_002278558.1| PREDICTED: pentatricopeptide repeat-containi... 120 1e-25 ref|XP_002533116.1| pentatricopeptide repeat-containing protein,... 112 2e-23 ref|XP_003553062.1| PREDICTED: pentatricopeptide repeat-containi... 110 2e-22 ref|XP_002323869.1| predicted protein [Populus trichocarpa] gi|2... 104 8e-21 >emb|CBI22241.3| unnamed protein product [Vitis vinifera] Length = 1256 Score = 120 bits (301), Expect = 1e-25 Identities = 59/102 (57%), Positives = 78/102 (76%) Frame = +2 Query: 2 NILIFHLFASRNSVCVDMVLDEIQEKGLEFDSVTYNFLVYGFFRCKAVSRSLQYLTAMMS 181 NILI+HLF + NS+ V ++L E+ +KGL FD VTYNFLVYGF + K V S+QYLTAM+S Sbjct: 938 NILIYHLFQTGNSLLVKVILGELHKKGLLFDEVTYNFLVYGFLQSKDVPTSVQYLTAMIS 997 Query: 182 KELKPSNRCLRALITSLRSGGEVKNVLKLSQEMETRSWVHCS 307 KEL+PS+R LRA+I+ L G ++ L+LS+EME R W+H S Sbjct: 998 KELRPSSRNLRAVISCLCDSGMLRKALELSREMELRGWIHGS 1039 >ref|XP_002278558.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15280-like [Vitis vinifera] Length = 1273 Score = 120 bits (301), Expect = 1e-25 Identities = 59/102 (57%), Positives = 78/102 (76%) Frame = +2 Query: 2 NILIFHLFASRNSVCVDMVLDEIQEKGLEFDSVTYNFLVYGFFRCKAVSRSLQYLTAMMS 181 NILI+HLF + NS+ V ++L E+ +KGL FD VTYNFLVYGF + K V S+QYLTAM+S Sbjct: 955 NILIYHLFQTGNSLLVKVILGELHKKGLLFDEVTYNFLVYGFLQSKDVPTSVQYLTAMIS 1014 Query: 182 KELKPSNRCLRALITSLRSGGEVKNVLKLSQEMETRSWVHCS 307 KEL+PS+R LRA+I+ L G ++ L+LS+EME R W+H S Sbjct: 1015 KELRPSSRNLRAVISCLCDSGMLRKALELSREMELRGWIHGS 1056 >ref|XP_002533116.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223527079|gb|EEF29261.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 1204 Score = 112 bits (281), Expect = 2e-23 Identities = 55/104 (52%), Positives = 74/104 (71%) Frame = +2 Query: 2 NILIFHLFASRNSVCVDMVLDEIQEKGLEFDSVTYNFLVYGFFRCKAVSRSLQYLTAMMS 181 NILIFHL ++ N + V VLDE+QEKGL + VTYNFLVYGF +CK V+ + Y++ M+S Sbjct: 876 NILIFHLLSAGNCLHVVRVLDELQEKGLLLNEVTYNFLVYGFSKCKDVASVVHYMSTMIS 935 Query: 182 KELKPSNRCLRALITSLRSGGEVKNVLKLSQEMETRSWVHCSKV 313 K KP+NR +R +T + G++ VL+LSQEME R W+H S V Sbjct: 936 KGFKPNNRSIRTAVTCMCDLGQLSEVLELSQEMEKRGWIHGSFV 979 >ref|XP_003553062.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15280-like [Glycine max] Length = 1186 Score = 110 bits (274), Expect = 2e-22 Identities = 54/104 (51%), Positives = 72/104 (69%) Frame = +2 Query: 2 NILIFHLFASRNSVCVDMVLDEIQEKGLEFDSVTYNFLVYGFFRCKAVSRSLQYLTAMMS 181 NIL+F+L NS+ V+ +L E++EK + D V +NFLVYGF +C+ +S SL YLT M+S Sbjct: 871 NILMFYLLKDGNSLDVNKILTEMEEKKVVLDEVGHNFLVYGFLQCRDLSSSLHYLTTMIS 930 Query: 182 KELKPSNRCLRALITSLRSGGEVKNVLKLSQEMETRSWVHCSKV 313 K LKPSNR LR +I+ L G +K LKLSQEM R W+H S + Sbjct: 931 KGLKPSNRSLRKVISKLCDAGNLKKALKLSQEMRLRGWMHDSSI 974 >ref|XP_002323869.1| predicted protein [Populus trichocarpa] gi|222866871|gb|EEF04002.1| predicted protein [Populus trichocarpa] Length = 1158 Score = 104 bits (259), Expect = 8e-21 Identities = 52/99 (52%), Positives = 71/99 (71%) Frame = +2 Query: 2 NILIFHLFASRNSVCVDMVLDEIQEKGLEFDSVTYNFLVYGFFRCKAVSRSLQYLTAMMS 181 NILIF+L + S+ V VL+E+QE+GL + VTYNFLVYGF +CK VS + YL+ M+S Sbjct: 836 NILIFYLLTAGESMHVKKVLNELQEEGLVLNEVTYNFLVYGFSKCKDVSTGMHYLSTMIS 895 Query: 182 KELKPSNRCLRALITSLRSGGEVKNVLKLSQEMETRSWV 298 KEL+PS R L +IT L GE+ VL+LS+E+E + W+ Sbjct: 896 KELRPSYRSLSTVITFLCDIGELDKVLELSREIELKGWI 934