BLASTX nr result
ID: Atractylodes22_contig00052206
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00052206 (253 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515332.1| conserved hypothetical protein [Ricinus comm... 72 2e-23 >ref|XP_002515332.1| conserved hypothetical protein [Ricinus communis] gi|223545812|gb|EEF47316.1| conserved hypothetical protein [Ricinus communis] Length = 171 Score = 72.4 bits (176), Expect(2) = 2e-23 Identities = 32/50 (64%), Positives = 39/50 (78%) Frame = -3 Query: 251 MVDKAENWISSYLSVRKNVDWNDFVIDLTTRFKDETGVNVVRTIQQITAT 102 MVDKAENW+SSYL R VDWNDFVID+ +RFKDE+G+NVV ++ T Sbjct: 74 MVDKAENWVSSYLINRTAVDWNDFVIDVNSRFKDESGINVVEEFNKLQQT 123 Score = 61.2 bits (147), Expect(2) = 2e-23 Identities = 27/42 (64%), Positives = 38/42 (90%) Frame = -1 Query: 127 EQFNKLQQHDSLEVYIDEFEKLRAIMLQNSHVLPDAYILDSF 2 E+FNKLQQ +SLE YIDEFEK+++ MLQNS+VLP+ ++++SF Sbjct: 115 EEFNKLQQTNSLEDYIDEFEKVKSSMLQNSYVLPEKHLMESF 156