BLASTX nr result
ID: Atractylodes22_contig00052009
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00052009 (203 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003593858.1| Serine carboxypeptidase-like protein [Medica... 117 1e-24 ref|XP_003593861.1| Serine carboxypeptidase family protein [Medi... 116 2e-24 ref|XP_003541676.1| PREDICTED: serine carboxypeptidase-like 12-l... 115 3e-24 ref|XP_002510077.1| serine carboxypeptidase, putative [Ricinus c... 115 3e-24 ref|XP_002510076.1| serine carboxypeptidase, putative [Ricinus c... 115 3e-24 >ref|XP_003593858.1| Serine carboxypeptidase-like protein [Medicago truncatula] gi|355482906|gb|AES64109.1| Serine carboxypeptidase-like protein [Medicago truncatula] Length = 469 Score = 117 bits (293), Expect = 1e-24 Identities = 49/67 (73%), Positives = 62/67 (92%) Frame = +3 Query: 3 YYFIQSESNPKDDPLMLWITGGPGCSSISGLLYEIGPIEFEAVHYNGSLPNLILRPNSWT 182 YYFI+SE NPKDDPL+LW+TGGPGCS++SGL+ EIGP+EF+ YNGSLPNLIL+P+SWT Sbjct: 64 YYFIESEKNPKDDPLILWLTGGPGCSALSGLMLEIGPLEFKKEEYNGSLPNLILKPHSWT 123 Query: 183 QIASIIF 203 +++SIIF Sbjct: 124 KVSSIIF 130 >ref|XP_003593861.1| Serine carboxypeptidase family protein [Medicago truncatula] gi|355482909|gb|AES64112.1| Serine carboxypeptidase family protein [Medicago truncatula] Length = 465 Score = 116 bits (290), Expect = 2e-24 Identities = 49/67 (73%), Positives = 62/67 (92%) Frame = +3 Query: 3 YYFIQSESNPKDDPLMLWITGGPGCSSISGLLYEIGPIEFEAVHYNGSLPNLILRPNSWT 182 YYFI+SE NPK+DPL+LW+TGGPGCS++SGL+YEIGPI F+ +YNGS+PNLILRP SWT Sbjct: 68 YYFIESERNPKEDPLLLWLTGGPGCSALSGLVYEIGPIMFKKEYYNGSVPNLILRPASWT 127 Query: 183 QIASIIF 203 +++SIIF Sbjct: 128 KVSSIIF 134 >ref|XP_003541676.1| PREDICTED: serine carboxypeptidase-like 12-like [Glycine max] Length = 546 Score = 115 bits (289), Expect = 3e-24 Identities = 48/67 (71%), Positives = 62/67 (92%) Frame = +3 Query: 3 YYFIQSESNPKDDPLMLWITGGPGCSSISGLLYEIGPIEFEAVHYNGSLPNLILRPNSWT 182 YYFI+SE+NPK DPLMLW+TGGPGCS++SGL++EIGP+ F+ YNGSLPNL+LRP+SWT Sbjct: 65 YYFIESENNPKKDPLMLWLTGGPGCSALSGLVFEIGPLTFKYEEYNGSLPNLVLRPHSWT 124 Query: 183 QIASIIF 203 +++SIIF Sbjct: 125 KVSSIIF 131 >ref|XP_002510077.1| serine carboxypeptidase, putative [Ricinus communis] gi|223550778|gb|EEF52264.1| serine carboxypeptidase, putative [Ricinus communis] Length = 468 Score = 115 bits (289), Expect = 3e-24 Identities = 49/67 (73%), Positives = 59/67 (88%) Frame = +3 Query: 3 YYFIQSESNPKDDPLMLWITGGPGCSSISGLLYEIGPIEFEAVHYNGSLPNLILRPNSWT 182 YYF++S+ N K+DPL+LW+TGGPGCS +SGLLYEIGP+ FE V YNGSLP LIL P+SWT Sbjct: 61 YYFVKSQRNAKEDPLLLWLTGGPGCSGLSGLLYEIGPLTFEVVEYNGSLPTLILNPHSWT 120 Query: 183 QIASIIF 203 Q+ASIIF Sbjct: 121 QVASIIF 127 >ref|XP_002510076.1| serine carboxypeptidase, putative [Ricinus communis] gi|223550777|gb|EEF52263.1| serine carboxypeptidase, putative [Ricinus communis] Length = 453 Score = 115 bits (289), Expect = 3e-24 Identities = 49/67 (73%), Positives = 60/67 (89%) Frame = +3 Query: 3 YYFIQSESNPKDDPLMLWITGGPGCSSISGLLYEIGPIEFEAVHYNGSLPNLILRPNSWT 182 YYF++S+ N K+DPL+LW+TGGPGCS++SGLLYEIGP+ F+AV YNGSLP LIL P SWT Sbjct: 46 YYFVKSQGNAKEDPLLLWLTGGPGCSALSGLLYEIGPLHFKAVEYNGSLPTLILNPYSWT 105 Query: 183 QIASIIF 203 Q+ASIIF Sbjct: 106 QVASIIF 112