BLASTX nr result
ID: Atractylodes22_contig00051623
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00051623 (273 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABP96804.1| receptor-like protein kinase [Capsicum annuum] 59 4e-07 ref|XP_002329342.1| predicted protein [Populus trichocarpa] gi|2... 59 4e-07 ref|XP_003592595.1| Receptor-like kinase [Medicago truncatula] g... 58 9e-07 ref|XP_002868005.1| hypothetical protein ARALYDRAFT_493041 [Arab... 57 1e-06 ref|XP_002317905.1| predicted protein [Populus trichocarpa] gi|2... 57 1e-06 >gb|ABP96804.1| receptor-like protein kinase [Capsicum annuum] Length = 627 Score = 58.9 bits (141), Expect = 4e-07 Identities = 24/35 (68%), Positives = 32/35 (91%) Frame = +1 Query: 1 WCIQTNPLSRPTITKVLEMLEGDLASMEIPPKPYL 105 WCIQT+P +RP+++KV+EMLEG L S++IPPKPYL Sbjct: 570 WCIQTDPSNRPSMSKVVEMLEGKLDSLQIPPKPYL 604 >ref|XP_002329342.1| predicted protein [Populus trichocarpa] gi|222870796|gb|EEF07927.1| predicted protein [Populus trichocarpa] Length = 580 Score = 58.9 bits (141), Expect = 4e-07 Identities = 23/35 (65%), Positives = 30/35 (85%) Frame = +1 Query: 1 WCIQTNPLSRPTITKVLEMLEGDLASMEIPPKPYL 105 WC+QTNPL RP++TKV+EMLEG L ++ PPKP+L Sbjct: 546 WCVQTNPLDRPSMTKVVEMLEGSLQFLQTPPKPFL 580 >ref|XP_003592595.1| Receptor-like kinase [Medicago truncatula] gi|355481643|gb|AES62846.1| Receptor-like kinase [Medicago truncatula] Length = 327 Score = 57.8 bits (138), Expect = 9e-07 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +1 Query: 1 WCIQTNPLSRPTITKVLEMLEGDLASMEIPPKPYL 105 WCIQT+PL+RP + KV+EMLEG L +EIPPKP+L Sbjct: 278 WCIQTDPLNRPAMHKVVEMLEGSLQVLEIPPKPFL 312 >ref|XP_002868005.1| hypothetical protein ARALYDRAFT_493041 [Arabidopsis lyrata subsp. lyrata] gi|297313841|gb|EFH44264.1| hypothetical protein ARALYDRAFT_493041 [Arabidopsis lyrata subsp. lyrata] Length = 852 Score = 57.4 bits (137), Expect = 1e-06 Identities = 23/35 (65%), Positives = 29/35 (82%) Frame = +1 Query: 1 WCIQTNPLSRPTITKVLEMLEGDLASMEIPPKPYL 105 WCIQTNPL RP + KV+EMLEG L ++++PPKP L Sbjct: 773 WCIQTNPLDRPPMRKVVEMLEGSLEALQVPPKPLL 807 >ref|XP_002317905.1| predicted protein [Populus trichocarpa] gi|222858578|gb|EEE96125.1| predicted protein [Populus trichocarpa] Length = 300 Score = 57.4 bits (137), Expect = 1e-06 Identities = 22/35 (62%), Positives = 30/35 (85%) Frame = +1 Query: 1 WCIQTNPLSRPTITKVLEMLEGDLASMEIPPKPYL 105 WCIQTNP RP+++KVLEMLEG + ++ IPP+P+L Sbjct: 266 WCIQTNPADRPSMSKVLEMLEGPIGALNIPPRPFL 300