BLASTX nr result
ID: Atractylodes22_contig00051170
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00051170 (214 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514156.1| pentatricopeptide repeat-containing protein,... 60 3e-12 ref|XP_003633097.1| PREDICTED: pentatricopeptide repeat-containi... 58 2e-11 ref|XP_004158941.1| PREDICTED: putative pentatricopeptide repeat... 54 1e-09 ref|XP_004147002.1| PREDICTED: putative pentatricopeptide repeat... 54 1e-09 emb|CBI27939.3| unnamed protein product [Vitis vinifera] 49 9e-09 >ref|XP_002514156.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223546612|gb|EEF48110.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 885 Score = 60.5 bits (145), Expect(2) = 3e-12 Identities = 27/45 (60%), Positives = 36/45 (80%) Frame = -2 Query: 210 LRRYSEKLRDCAANRSVNEGKAIHKQIMESDIELDSHLWVSLINL 76 L+RYS LR+CA+ ++NEG AIH +++S +E DSHLWVSLINL Sbjct: 93 LKRYSGMLRECASKGNLNEGTAIHGNVIKSGLEPDSHLWVSLINL 137 Score = 35.8 bits (81), Expect(2) = 3e-12 Identities = 16/26 (61%), Positives = 20/26 (76%) Frame = -3 Query: 80 IYAKCGCLSVARQVLDEMPQGDVVSW 3 +YAKCG L+ AR+VL M + DVVSW Sbjct: 137 LYAKCGSLAFARKVLVGMRERDVVSW 162 >ref|XP_003633097.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650-like [Vitis vinifera] Length = 1005 Score = 58.2 bits (139), Expect(2) = 2e-11 Identities = 26/46 (56%), Positives = 35/46 (76%) Frame = -2 Query: 213 KLRRYSEKLRDCAANRSVNEGKAIHKQIMESDIELDSHLWVSLINL 76 +LR+YS LR CA+ +NEGKAIH Q+++S I DSHLW SL+N+ Sbjct: 127 RLRQYSGMLRTCASKGDLNEGKAIHGQVIKSGINPDSHLWNSLVNV 172 Score = 35.0 bits (79), Expect(2) = 2e-11 Identities = 14/26 (53%), Positives = 19/26 (73%) Frame = -3 Query: 80 IYAKCGCLSVARQVLDEMPQGDVVSW 3 +YAKCG + A +V E+P+ DVVSW Sbjct: 172 VYAKCGSANYACKVFGEIPERDVVSW 197 >ref|XP_004158941.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g09950-like [Cucumis sativus] Length = 1004 Score = 53.9 bits (128), Expect(2) = 1e-09 Identities = 25/46 (54%), Positives = 33/46 (71%) Frame = -2 Query: 213 KLRRYSEKLRDCAANRSVNEGKAIHKQIMESDIELDSHLWVSLINL 76 KL+ YS LR+CA+ RS+ KAIH I++ I DSHLWVSL+N+ Sbjct: 111 KLKYYSSMLRECASKRSLGVAKAIHGLIVKDVINPDSHLWVSLVNV 156 Score = 33.5 bits (75), Expect(2) = 1e-09 Identities = 15/26 (57%), Positives = 18/26 (69%) Frame = -3 Query: 80 IYAKCGCLSVARQVLDEMPQGDVVSW 3 +YAKC + AR VL +MP DVVSW Sbjct: 156 VYAKCRYSAYARLVLAKMPDRDVVSW 181 >ref|XP_004147002.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g09950-like [Cucumis sativus] Length = 989 Score = 53.9 bits (128), Expect(2) = 1e-09 Identities = 25/46 (54%), Positives = 33/46 (71%) Frame = -2 Query: 213 KLRRYSEKLRDCAANRSVNEGKAIHKQIMESDIELDSHLWVSLINL 76 KL+ YS LR+CA+ RS+ KAIH I++ I DSHLWVSL+N+ Sbjct: 111 KLKYYSSMLRECASKRSLGVAKAIHGLIVKDVINPDSHLWVSLVNV 156 Score = 33.5 bits (75), Expect(2) = 1e-09 Identities = 15/26 (57%), Positives = 18/26 (69%) Frame = -3 Query: 80 IYAKCGCLSVARQVLDEMPQGDVVSW 3 +YAKC + AR VL +MP DVVSW Sbjct: 156 VYAKCRYSAYARLVLAKMPDRDVVSW 181 >emb|CBI27939.3| unnamed protein product [Vitis vinifera] Length = 764 Score = 49.3 bits (116), Expect(2) = 9e-09 Identities = 21/38 (55%), Positives = 29/38 (76%) Frame = -2 Query: 189 LRDCAANRSVNEGKAIHKQIMESDIELDSHLWVSLINL 76 L+ CA+ +NEGKAIH Q+++S I DSHLW SL+N+ Sbjct: 198 LKTCASKGDLNEGKAIHGQVIKSGINPDSHLWNSLVNV 235 Score = 35.0 bits (79), Expect(2) = 9e-09 Identities = 14/26 (53%), Positives = 19/26 (73%) Frame = -3 Query: 80 IYAKCGCLSVARQVLDEMPQGDVVSW 3 +YAKCG + A +V E+P+ DVVSW Sbjct: 235 VYAKCGSANYACKVFGEIPERDVVSW 260