BLASTX nr result
ID: Atractylodes22_contig00051080
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00051080 (217 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002297691.1| predicted protein [Populus trichocarpa] gi|2... 59 4e-07 ref|XP_002297684.1| predicted protein [Populus trichocarpa] gi|2... 59 5e-07 ref|XP_002297687.1| predicted protein [Populus trichocarpa] gi|2... 57 2e-06 ref|XP_002333794.1| predicted protein [Populus trichocarpa] gi|2... 56 3e-06 ref|XP_002336350.1| predicted protein [Populus trichocarpa] gi|2... 56 3e-06 >ref|XP_002297691.1| predicted protein [Populus trichocarpa] gi|222844949|gb|EEE82496.1| predicted protein [Populus trichocarpa] Length = 721 Score = 58.9 bits (141), Expect = 4e-07 Identities = 19/31 (61%), Positives = 28/31 (90%) Frame = +1 Query: 124 ISKPGCLHTCGNVTIPYPFGIGTNCFMNEWY 216 ++KP C+ TCGN++IP+PFGIGT C+MN+W+ Sbjct: 1 MAKPNCIDTCGNISIPFPFGIGTGCYMNDWF 31 >ref|XP_002297684.1| predicted protein [Populus trichocarpa] gi|222844942|gb|EEE82489.1| predicted protein [Populus trichocarpa] Length = 722 Score = 58.5 bits (140), Expect = 5e-07 Identities = 19/31 (61%), Positives = 27/31 (87%) Frame = +1 Query: 124 ISKPGCLHTCGNVTIPYPFGIGTNCFMNEWY 216 +++P C TCGN+TIP+PFGIGT C+MN+W+ Sbjct: 27 MARPNCTETCGNITIPFPFGIGTGCYMNDWF 57 >ref|XP_002297687.1| predicted protein [Populus trichocarpa] gi|222844945|gb|EEE82492.1| predicted protein [Populus trichocarpa] Length = 348 Score = 57.0 bits (136), Expect = 2e-06 Identities = 20/31 (64%), Positives = 26/31 (83%) Frame = +1 Query: 124 ISKPGCLHTCGNVTIPYPFGIGTNCFMNEWY 216 I+KP C TCGN++IP+PFGIGT C MN+W+ Sbjct: 27 IAKPNCADTCGNISIPFPFGIGTGCSMNDWF 57 >ref|XP_002333794.1| predicted protein [Populus trichocarpa] gi|222838515|gb|EEE76880.1| predicted protein [Populus trichocarpa] Length = 294 Score = 56.2 bits (134), Expect = 3e-06 Identities = 18/31 (58%), Positives = 26/31 (83%) Frame = +1 Query: 124 ISKPGCLHTCGNVTIPYPFGIGTNCFMNEWY 216 +++P C TCGN++IP+PFGIGT C+MN W+ Sbjct: 1 MARPNCAETCGNISIPFPFGIGTGCYMNNWF 31 >ref|XP_002336350.1| predicted protein [Populus trichocarpa] gi|222834776|gb|EEE73239.1| predicted protein [Populus trichocarpa] Length = 546 Score = 55.8 bits (133), Expect = 3e-06 Identities = 17/31 (54%), Positives = 27/31 (87%) Frame = +1 Query: 124 ISKPGCLHTCGNVTIPYPFGIGTNCFMNEWY 216 +++P C+ TCGN++IP+PFGIG C+MN+W+ Sbjct: 1 MARPNCIDTCGNISIPFPFGIGAGCYMNDWF 31