BLASTX nr result
ID: Atractylodes22_contig00051052
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00051052 (245 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI39798.3| unnamed protein product [Vitis vinifera] 143 1e-32 ref|XP_003537070.1| PREDICTED: kinesin-4-like [Glycine max] 142 2e-32 ref|XP_003530813.1| PREDICTED: kinesin-4-like [Glycine max] 142 4e-32 ref|XP_002532168.1| kinesin heavy chain, putative [Ricinus commu... 141 5e-32 ref|XP_002330598.1| predicted protein [Populus trichocarpa] gi|2... 141 5e-32 >emb|CBI39798.3| unnamed protein product [Vitis vinifera] Length = 1114 Score = 143 bits (361), Expect = 1e-32 Identities = 72/81 (88%), Positives = 77/81 (95%) Frame = -2 Query: 244 PYRNSKLTQVLQDSLGGHAKTLMFVHINPETNAIGETISTLKFAERVASIELGAARSNKE 65 PYRNSKLTQVLQDSLGG AKTLMFVHINPE NAIGETISTLKFAERV+SIELGAARSNKE Sbjct: 778 PYRNSKLTQVLQDSLGGQAKTLMFVHINPEVNAIGETISTLKFAERVSSIELGAARSNKE 837 Query: 64 AGEIRDMKEEISNLKLLVEKQ 2 GEIRD+KEEISNLKL +E++ Sbjct: 838 TGEIRDLKEEISNLKLTMERK 858 >ref|XP_003537070.1| PREDICTED: kinesin-4-like [Glycine max] Length = 1139 Score = 142 bits (359), Expect = 2e-32 Identities = 71/81 (87%), Positives = 78/81 (96%) Frame = -2 Query: 244 PYRNSKLTQVLQDSLGGHAKTLMFVHINPETNAIGETISTLKFAERVASIELGAARSNKE 65 PYRNSKLTQVLQDSLGGHAKTLMFVHINPE NAIGETISTLKFAERV+SIELGAA+SNKE Sbjct: 714 PYRNSKLTQVLQDSLGGHAKTLMFVHINPELNAIGETISTLKFAERVSSIELGAAQSNKE 773 Query: 64 AGEIRDMKEEISNLKLLVEKQ 2 GEIRD+KEEIS+L+L +EK+ Sbjct: 774 TGEIRDLKEEISSLRLALEKK 794 >ref|XP_003530813.1| PREDICTED: kinesin-4-like [Glycine max] Length = 1140 Score = 142 bits (357), Expect = 4e-32 Identities = 70/81 (86%), Positives = 78/81 (96%) Frame = -2 Query: 244 PYRNSKLTQVLQDSLGGHAKTLMFVHINPETNAIGETISTLKFAERVASIELGAARSNKE 65 PYRNSKLTQVLQDSLGGHAKTLMFVHINPE NAIGET+STLKFAERV+SIELGAA+SNKE Sbjct: 713 PYRNSKLTQVLQDSLGGHAKTLMFVHINPELNAIGETLSTLKFAERVSSIELGAAQSNKE 772 Query: 64 AGEIRDMKEEISNLKLLVEKQ 2 GEIRD+KEEIS+L+L +EK+ Sbjct: 773 TGEIRDLKEEISSLRLALEKK 793 >ref|XP_002532168.1| kinesin heavy chain, putative [Ricinus communis] gi|223528136|gb|EEF30205.1| kinesin heavy chain, putative [Ricinus communis] Length = 1114 Score = 141 bits (356), Expect = 5e-32 Identities = 71/81 (87%), Positives = 77/81 (95%) Frame = -2 Query: 244 PYRNSKLTQVLQDSLGGHAKTLMFVHINPETNAIGETISTLKFAERVASIELGAARSNKE 65 PYRNSKLTQVLQDSLGG AKTLMFVHINPE NAIGETISTLKFAERVASIELGAARSNKE Sbjct: 668 PYRNSKLTQVLQDSLGGQAKTLMFVHINPEVNAIGETISTLKFAERVASIELGAARSNKE 727 Query: 64 AGEIRDMKEEISNLKLLVEKQ 2 GEIR++KEEISNLK ++E++ Sbjct: 728 TGEIRELKEEISNLKEMLERK 748 >ref|XP_002330598.1| predicted protein [Populus trichocarpa] gi|222872156|gb|EEF09287.1| predicted protein [Populus trichocarpa] Length = 1129 Score = 141 bits (356), Expect = 5e-32 Identities = 70/81 (86%), Positives = 77/81 (95%) Frame = -2 Query: 244 PYRNSKLTQVLQDSLGGHAKTLMFVHINPETNAIGETISTLKFAERVASIELGAARSNKE 65 PYRNSKLTQVLQDSLGGHAKTLMFVHINPE N+IGETISTLKFAERVAS+ELGAARSNKE Sbjct: 709 PYRNSKLTQVLQDSLGGHAKTLMFVHINPELNSIGETISTLKFAERVASVELGAARSNKE 768 Query: 64 AGEIRDMKEEISNLKLLVEKQ 2 GEIR++KEEISNLK +E++ Sbjct: 769 TGEIRELKEEISNLKEALERK 789