BLASTX nr result
ID: Atractylodes22_contig00050964
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00050964 (205 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002282579.1| PREDICTED: putative S-adenosyl-L-methionine-... 58 9e-07 emb|CBI19696.3| unnamed protein product [Vitis vinifera] 58 9e-07 emb|CAN75691.1| hypothetical protein VITISV_038532 [Vitis vinifera] 58 9e-07 ref|XP_002510385.1| conserved hypothetical protein [Ricinus comm... 56 3e-06 >ref|XP_002282579.1| PREDICTED: putative S-adenosyl-L-methionine-dependent methyltransferase Mvan_1345-like [Vitis vinifera] Length = 352 Score = 57.8 bits (138), Expect = 9e-07 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -2 Query: 204 RLNNAREVSGVILAVRTLWFESKLEAAVKSF 112 RLNNARE+SGVILAVRTLWF+SKLEAA+ SF Sbjct: 105 RLNNAREISGVILAVRTLWFDSKLEAALSSF 135 >emb|CBI19696.3| unnamed protein product [Vitis vinifera] Length = 332 Score = 57.8 bits (138), Expect = 9e-07 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -2 Query: 204 RLNNAREVSGVILAVRTLWFESKLEAAVKSF 112 RLNNARE+SGVILAVRTLWF+SKLEAA+ SF Sbjct: 85 RLNNAREISGVILAVRTLWFDSKLEAALSSF 115 >emb|CAN75691.1| hypothetical protein VITISV_038532 [Vitis vinifera] Length = 332 Score = 57.8 bits (138), Expect = 9e-07 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -2 Query: 204 RLNNAREVSGVILAVRTLWFESKLEAAVKSF 112 RLNNARE+SGVILAVRTLWF+SKLEAA+ SF Sbjct: 85 RLNNAREISGVILAVRTLWFDSKLEAALSSF 115 >ref|XP_002510385.1| conserved hypothetical protein [Ricinus communis] gi|223551086|gb|EEF52572.1| conserved hypothetical protein [Ricinus communis] Length = 331 Score = 56.2 bits (134), Expect = 3e-06 Identities = 25/31 (80%), Positives = 31/31 (100%) Frame = -2 Query: 204 RLNNAREVSGVILAVRTLWFESKLEAAVKSF 112 +LNNARE+SGV+LAVRTLWF+SKLEAA++SF Sbjct: 85 QLNNAREISGVLLAVRTLWFDSKLEAALRSF 115