BLASTX nr result
ID: Atractylodes22_contig00050721
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00050721 (306 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002307138.1| predicted protein [Populus trichocarpa] gi|2... 76 3e-12 emb|CBI21532.3| unnamed protein product [Vitis vinifera] 74 9e-12 emb|CAN64414.1| hypothetical protein VITISV_014074 [Vitis vinifera] 74 2e-11 ref|XP_002530252.1| conserved hypothetical protein [Ricinus comm... 69 3e-10 ref|XP_002275681.2| PREDICTED: uncharacterized protein LOC100247... 69 4e-10 >ref|XP_002307138.1| predicted protein [Populus trichocarpa] gi|222856587|gb|EEE94134.1| predicted protein [Populus trichocarpa] Length = 434 Score = 75.9 bits (185), Expect = 3e-12 Identities = 42/91 (46%), Positives = 59/91 (64%), Gaps = 2/91 (2%) Frame = -1 Query: 306 EIIRNMQCRLATKFKKSGTRLGDGLKPLEFVDSELSQDDPELPKLSTDASSLETMNEQEY 127 EIIRN+Q RL++KFKK+G RL DG + L V++ LSQD+ +L LS DA+ ET N++E Sbjct: 103 EIIRNLQYRLSSKFKKTGLRLMDGREELSLVEANLSQDESQLSVLSADAALSETPNQEEL 162 Query: 126 PTGMKS--ATSEKHALMSMDPFDSRPYSDLE 40 + S + +EK LM D D R + D+E Sbjct: 163 LASVSSVGSNNEKLVLMYQDSLDFRTHLDIE 193 >emb|CBI21532.3| unnamed protein product [Vitis vinifera] Length = 760 Score = 74.3 bits (181), Expect = 9e-12 Identities = 42/90 (46%), Positives = 57/90 (63%), Gaps = 3/90 (3%) Frame = -1 Query: 306 EIIRNMQCRLATKFKKSGTRLGDGLKPLEFVDSELSQDDPELPKLSTDASSLETMNEQE- 130 EIIRN+QC+L+ KFK+ L DG + L +D L QDD +L LS DA SL T+N+ E Sbjct: 54 EIIRNLQCQLSAKFKRPSQVLADGAEALSVMDMNLLQDDAQLSILSADAISLATLNQHEL 113 Query: 129 -YP-TGMKSATSEKHALMSMDPFDSRPYSD 46 +P +G+ +EK ALM M+ DS+ Y D Sbjct: 114 SFPVSGLGFNDTEKLALMPMESLDSKTYLD 143 >emb|CAN64414.1| hypothetical protein VITISV_014074 [Vitis vinifera] Length = 424 Score = 73.6 bits (179), Expect = 2e-11 Identities = 42/90 (46%), Positives = 56/90 (62%), Gaps = 3/90 (3%) Frame = -1 Query: 306 EIIRNMQCRLATKFKKSGTRLGDGLKPLEFVDSELSQDDPELPKLSTDASSLETMNEQE- 130 EIIRN+QC L+ KFK+ L DG + L +D L QDD +L LS DA SL T+N+ E Sbjct: 103 EIIRNLQCXLSAKFKRPSQVLADGAEALSVMDMNLLQDDAQLSILSADAISLATLNQHEL 162 Query: 129 -YP-TGMKSATSEKHALMSMDPFDSRPYSD 46 +P +G+ +EK ALM M+ DS+ Y D Sbjct: 163 SFPVSGLGFNDTEKLALMPMESLDSKTYLD 192 >ref|XP_002530252.1| conserved hypothetical protein [Ricinus communis] gi|223530218|gb|EEF32122.1| conserved hypothetical protein [Ricinus communis] Length = 2382 Score = 69.3 bits (168), Expect = 3e-10 Identities = 45/91 (49%), Positives = 58/91 (63%), Gaps = 2/91 (2%) Frame = -1 Query: 306 EIIRNMQCRLATKFKKSGTRLGDGLKPLEFVDSELSQDDPELPKLSTDASSLETMNEQEY 127 EIIRNMQ RL +FKK G L DG K L ++++L +D +LP LS +ASSLET+N+QE Sbjct: 101 EIIRNMQNRLRAQFKKRGQGLVDG-KALN-LETDLFEDKSQLPVLSANASSLETLNQQEL 158 Query: 126 PTGMKS--ATSEKHALMSMDPFDSRPYSDLE 40 S ++E+ ALMS D DS Y D E Sbjct: 159 SISATSMGTSTEQLALMSKDALDSSVYLDQE 189 >ref|XP_002275681.2| PREDICTED: uncharacterized protein LOC100247348 [Vitis vinifera] Length = 3288 Score = 68.9 bits (167), Expect = 4e-10 Identities = 41/90 (45%), Positives = 56/90 (62%), Gaps = 3/90 (3%) Frame = -1 Query: 306 EIIRNMQCRLATKFKKSGTRLGDGLKPLEFVDSELSQDDPELPKLSTDASSLETMNEQE- 130 EIIRN+QC+L+ KFK+ DG + L +D L QDD +L LS DA SL T+N+ E Sbjct: 984 EIIRNLQCQLSAKFKRPSQ--ADGAEALSVMDMNLLQDDAQLSILSADAISLATLNQHEL 1041 Query: 129 -YP-TGMKSATSEKHALMSMDPFDSRPYSD 46 +P +G+ +EK ALM M+ DS+ Y D Sbjct: 1042 SFPVSGLGFNDTEKLALMPMESLDSKTYLD 1071