BLASTX nr result
ID: Atractylodes22_contig00050697
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00050697 (234 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002270419.1| PREDICTED: phosphatidylinositol-4-phosphate ... 67 2e-09 >ref|XP_002270419.1| PREDICTED: phosphatidylinositol-4-phosphate 5-kinase 8-like [Vitis vinifera] Length = 789 Score = 66.6 bits (161), Expect = 2e-09 Identities = 38/77 (49%), Positives = 49/77 (63%), Gaps = 8/77 (10%) Frame = +2 Query: 26 KKALISPGSSFRSERF--------RDMKRSIGRSLSDKISTNGFFRDSGRISSKRISLEE 181 +K ++S SS SE R + +I RSLS+KIST GFFR SGRIS + +SL+E Sbjct: 217 RKTMLSHSSSLNSEGHGALKPSVSRSLSETISRSLSEKISTAGFFRSSGRISHRAMSLDE 276 Query: 182 DRTIGDSAREFSAFDKS 232 D ++ DSAREF A D S Sbjct: 277 DCSVCDSAREFLAHDTS 293