BLASTX nr result
ID: Atractylodes22_contig00050654
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00050654 (288 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACY01928.1| hypothetical protein [Beta vulgaris] 61 8e-08 >gb|ACY01928.1| hypothetical protein [Beta vulgaris] Length = 1583 Score = 61.2 bits (147), Expect = 8e-08 Identities = 31/88 (35%), Positives = 45/88 (51%) Frame = +1 Query: 1 ALLELQTGIQHQIEAQMAMMTQAIRDEMQTVLSDGMNPFAGVRQYGSPRNSGTPPQQNGG 180 A+ LQ + QI + TQ +R+E+ + G R+ G GG Sbjct: 35 AVETLQETLATQIAVSLERATQQLREEVAKIQERGDERRDERRENDDGEGEGFGGGFRGG 94 Query: 181 SNWRFRKLDMPLFDGSNPDGWIFRVERY 264 +WR +KLD+P+F G+NPDGWI R ER+ Sbjct: 95 GSWRAKKLDLPVFSGNNPDGWIIRAERF 122