BLASTX nr result
ID: Atractylodes22_contig00050523
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00050523 (287 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003540577.1| PREDICTED: LOW QUALITY PROTEIN: protein RFT1... 70 2e-10 ref|XP_003534407.1| PREDICTED: protein RFT1 homolog [Glycine max] 70 2e-10 ref|XP_002510976.1| Oligosaccharide translocation protein rft1, ... 69 3e-10 ref|XP_004146915.1| PREDICTED: protein RFT1 homolog [Cucumis sat... 68 7e-10 ref|NP_196380.5| lipid transporter [Arabidopsis thaliana] gi|332... 57 2e-06 >ref|XP_003540577.1| PREDICTED: LOW QUALITY PROTEIN: protein RFT1 homolog [Glycine max] Length = 518 Score = 70.1 bits (170), Expect = 2e-10 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +2 Query: 179 AANLPRTFKYLLATQFLSRGIPFIFNSWIVRHLTEE 286 A NL RTFKYLLATQFLSRGIPFIFN+WIVRHLT+E Sbjct: 7 ATNLSRTFKYLLATQFLSRGIPFIFNTWIVRHLTQE 42 >ref|XP_003534407.1| PREDICTED: protein RFT1 homolog [Glycine max] Length = 518 Score = 70.1 bits (170), Expect = 2e-10 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +2 Query: 179 AANLPRTFKYLLATQFLSRGIPFIFNSWIVRHLTEE 286 A NL RTFKYLLATQFLSRGIPFIFN+WIVRHLT+E Sbjct: 7 ATNLSRTFKYLLATQFLSRGIPFIFNTWIVRHLTQE 42 >ref|XP_002510976.1| Oligosaccharide translocation protein rft1, putative [Ricinus communis] gi|223550091|gb|EEF51578.1| Oligosaccharide translocation protein rft1, putative [Ricinus communis] Length = 436 Score = 69.3 bits (168), Expect = 3e-10 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +2 Query: 182 ANLPRTFKYLLATQFLSRGIPFIFNSWIVRHLTEE 286 AN RTFKYLLATQFLSRGIPFIFNSWI+RHLTE+ Sbjct: 16 ANFSRTFKYLLATQFLSRGIPFIFNSWIIRHLTEQ 50 >ref|XP_004146915.1| PREDICTED: protein RFT1 homolog [Cucumis sativus] gi|449520289|ref|XP_004167166.1| PREDICTED: protein RFT1 homolog [Cucumis sativus] Length = 528 Score = 68.2 bits (165), Expect = 7e-10 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = +2 Query: 179 AANLPRTFKYLLATQFLSRGIPFIFNSWIVRHLTEE 286 A NL RTF+YL+ATQFLSRGIPFIFN WIVRHLTEE Sbjct: 18 ATNLSRTFRYLMATQFLSRGIPFIFNLWIVRHLTEE 53 >ref|NP_196380.5| lipid transporter [Arabidopsis thaliana] gi|332003804|gb|AED91187.1| lipid transporter [Arabidopsis thaliana] Length = 611 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/39 (64%), Positives = 30/39 (76%) Frame = +2 Query: 167 DGDPAANLPRTFKYLLATQFLSRGIPFIFNSWIVRHLTE 283 + D NL R FK+ L+ QF+SR IPF+FNSWIVRHLTE Sbjct: 93 NSDNNVNLSRIFKFSLSRQFISRSIPFVFNSWIVRHLTE 131