BLASTX nr result
ID: Atractylodes22_contig00050497
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00050497 (310 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003604571.1| Gamma-interferon-inducible lysosomal thiol r... 84 2e-14 ref|XP_002323009.1| predicted protein [Populus trichocarpa] gi|1... 80 2e-13 ref|NP_001239975.1| uncharacterized protein LOC100784702 [Glycin... 77 2e-12 ref|XP_003516977.1| PREDICTED: gamma-interferon-inducible lysoso... 74 9e-12 ref|XP_003604570.1| Gamma-interferon-inducible lysosomal thiol r... 74 2e-11 >ref|XP_003604571.1| Gamma-interferon-inducible lysosomal thiol reductase [Medicago truncatula] gi|355505626|gb|AES86768.1| Gamma-interferon-inducible lysosomal thiol reductase [Medicago truncatula] Length = 261 Score = 83.6 bits (205), Expect = 2e-14 Identities = 38/67 (56%), Positives = 45/67 (67%), Gaps = 2/67 (2%) Frame = -2 Query: 309 HRFVPWVLINNKPLQEDYQNFIAYICKAYKGQNKPKACNQHALEV--DSFKVANFSRHGC 136 H FVPWV++NN LQEDYQNF+ YICKAYKG KP AC + DS +N HGC Sbjct: 184 HTFVPWVVVNNHALQEDYQNFVTYICKAYKGSLKPDACRSVSTRTYYDSDAKSNSFHHGC 243 Query: 135 YLDENKH 115 Y+DE K+ Sbjct: 244 YVDEAKN 250 >ref|XP_002323009.1| predicted protein [Populus trichocarpa] gi|118482314|gb|ABK93083.1| unknown [Populus trichocarpa] gi|222867639|gb|EEF04770.1| predicted protein [Populus trichocarpa] Length = 242 Score = 79.7 bits (195), Expect = 2e-13 Identities = 31/65 (47%), Positives = 47/65 (72%) Frame = -2 Query: 309 HRFVPWVLINNKPLQEDYQNFIAYICKAYKGQNKPKACNQHALEVDSFKVANFSRHGCYL 130 HRFVPWV++NN+PL+ED++NF++Y+CKAY+G P+AC LE +S + N CY+ Sbjct: 169 HRFVPWVVVNNQPLREDFENFVSYVCKAYRGTKIPEACKSLPLESNSSQKENHINSVCYV 228 Query: 129 DENKH 115 D+ + Sbjct: 229 DQTSN 233 >ref|NP_001239975.1| uncharacterized protein LOC100784702 [Glycine max] gi|255642451|gb|ACU21489.1| unknown [Glycine max] Length = 184 Score = 76.6 bits (187), Expect = 2e-12 Identities = 37/74 (50%), Positives = 49/74 (66%), Gaps = 2/74 (2%) Frame = -2 Query: 309 HRFVPWVLINNKPLQEDYQNFIAYICKAYKGQNKPKACNQHALEV-DSFKVANFSRHGCY 133 HRFVPWV++NN+ LQEDYQNF+ YIC+AYKG P AC + + DS + N + CY Sbjct: 105 HRFVPWVVVNNQALQEDYQNFVTYICRAYKGNVIPNACRSLSTKTYDSNEKVNSFQPVCY 164 Query: 132 LDENKH-SLPFTYR 94 +DE ++ S P R Sbjct: 165 VDEARNLSFPLVTR 178 >ref|XP_003516977.1| PREDICTED: gamma-interferon-inducible lysosomal thiol reductase-like [Glycine max] Length = 263 Score = 74.3 bits (181), Expect = 9e-12 Identities = 34/66 (51%), Positives = 44/66 (66%), Gaps = 1/66 (1%) Frame = -2 Query: 309 HRFVPWVLINNKPLQEDYQNFIAYICKAYKGQNKPKACNQHALEV-DSFKVANFSRHGCY 133 HRFVPWV++NN+ LQEDYQNF+ YIC+AYKG P AC + DS + N CY Sbjct: 182 HRFVPWVVVNNQALQEDYQNFVTYICRAYKGNVIPNACRSLSTRTYDSNEKVNSFLPVCY 241 Query: 132 LDENKH 115 +DE ++ Sbjct: 242 VDEARN 247 >ref|XP_003604570.1| Gamma-interferon-inducible lysosomal thiol reductase [Medicago truncatula] gi|355505625|gb|AES86767.1| Gamma-interferon-inducible lysosomal thiol reductase [Medicago truncatula] Length = 351 Score = 73.6 bits (179), Expect = 2e-11 Identities = 39/85 (45%), Positives = 53/85 (62%), Gaps = 4/85 (4%) Frame = -2 Query: 309 HRFVPWVLINNKPLQEDYQNFIAYICKAYKGQNKPKACNQHALEV--DSFKVANFSRHGC 136 HRFVPWV++NN LQEDYQ+F+ YIC+AYKG+ KP AC + + D N C Sbjct: 185 HRFVPWVVVNNHALQEDYQDFMTYICRAYKGKVKPDACRSVSTKTYYDLNAKTNSFHPVC 244 Query: 135 YLDENKH--SLPFTYRF*YIMYNLL 67 Y+DE K+ L +++ I+Y LL Sbjct: 245 YVDEAKNLTLLTTSHQIKEILYLLL 269