BLASTX nr result
ID: Atractylodes22_contig00050448
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00050448 (374 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADN34260.1| N6-DNA-methyltransferase [Cucumis melo subsp. melo] 81 8e-14 ref|XP_004136904.1| PREDICTED: hemK methyltransferase family mem... 80 2e-13 ref|XP_002532710.1| n6-DNA-methyltransferase, putative [Ricinus ... 79 5e-13 ref|XP_002297908.1| predicted protein [Populus trichocarpa] gi|2... 62 4e-08 gb|ACU24432.1| unknown [Glycine max] 59 4e-07 >gb|ADN34260.1| N6-DNA-methyltransferase [Cucumis melo subsp. melo] Length = 256 Score = 81.3 bits (199), Expect = 8e-14 Identities = 40/64 (62%), Positives = 52/64 (81%) Frame = -1 Query: 374 QMRDKGYGAKIVVQRSTEEETLHVIKFWRDPDIQMEGNEVISTPKTARQRGLEFLLSQIS 195 QMR+KGY ++IVVQRSTEEE+LHVIKFW+D D+Q++G + ST KT R +E L+SQ+ Sbjct: 186 QMREKGYASRIVVQRSTEEESLHVIKFWKDADLQVDGKD--STHKTGPGRVVESLISQLP 243 Query: 194 RLSF 183 RLSF Sbjct: 244 RLSF 247 >ref|XP_004136904.1| PREDICTED: hemK methyltransferase family member 2-like [Cucumis sativus] gi|449529866|ref|XP_004171919.1| PREDICTED: hemK methyltransferase family member 2-like [Cucumis sativus] Length = 256 Score = 80.1 bits (196), Expect = 2e-13 Identities = 39/64 (60%), Positives = 52/64 (81%) Frame = -1 Query: 374 QMRDKGYGAKIVVQRSTEEETLHVIKFWRDPDIQMEGNEVISTPKTARQRGLEFLLSQIS 195 QMR+KGY ++IVVQRSTEEE+LHVIKFW+D D+Q++G + ST KT + +E L+SQ+ Sbjct: 186 QMREKGYASRIVVQRSTEEESLHVIKFWKDADLQVDGKD--STHKTGPGKVVESLISQLP 243 Query: 194 RLSF 183 RLSF Sbjct: 244 RLSF 247 >ref|XP_002532710.1| n6-DNA-methyltransferase, putative [Ricinus communis] gi|223527556|gb|EEF29677.1| n6-DNA-methyltransferase, putative [Ricinus communis] Length = 256 Score = 78.6 bits (192), Expect = 5e-13 Identities = 36/64 (56%), Positives = 50/64 (78%) Frame = -1 Query: 374 QMRDKGYGAKIVVQRSTEEETLHVIKFWRDPDIQMEGNEVISTPKTARQRGLEFLLSQIS 195 +MR KGY ++IVVQRSTEEE+LH+IKFWRD D Q + + ++T KT +R +E L+SQ+ Sbjct: 185 KMRKKGYASRIVVQRSTEEESLHIIKFWRDSDTQFDTKKTLTTNKTIPERVMESLVSQLP 244 Query: 194 RLSF 183 +LSF Sbjct: 245 QLSF 248 >ref|XP_002297908.1| predicted protein [Populus trichocarpa] gi|222845166|gb|EEE82713.1| predicted protein [Populus trichocarpa] Length = 228 Score = 62.4 bits (150), Expect = 4e-08 Identities = 27/38 (71%), Positives = 33/38 (86%) Frame = -1 Query: 371 MRDKGYGAKIVVQRSTEEETLHVIKFWRDPDIQMEGNE 258 MR KGY ++IVVQRSTEEE+LH+IKFWRD DIQ++ E Sbjct: 191 MRKKGYASRIVVQRSTEEESLHIIKFWRDSDIQLDTKE 228 >gb|ACU24432.1| unknown [Glycine max] Length = 234 Score = 58.9 bits (141), Expect = 4e-07 Identities = 29/39 (74%), Positives = 32/39 (82%) Frame = -1 Query: 374 QMRDKGYGAKIVVQRSTEEETLHVIKFWRDPDIQMEGNE 258 QMR KGY +KIVVQRSTEEE+LH+IKFWRD D E NE Sbjct: 190 QMRKKGYASKIVVQRSTEEESLHIIKFWRDFD--TEANE 226