BLASTX nr result
ID: Atractylodes22_contig00050139
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00050139 (297 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGC97441.1| NAC protein 11 [Gossypium hirsutum] 75 6e-12 ref|XP_004174070.1| PREDICTED: protein FEZ-like [Cucumis sativus] 62 4e-08 ref|XP_004144879.1| PREDICTED: protein FEZ-like [Cucumis sativus... 62 4e-08 ref|XP_004154545.1| PREDICTED: NAC domain-containing protein 19-... 62 5e-08 ref|XP_004154544.1| PREDICTED: NAC domain-containing protein 19-... 62 5e-08 >gb|AGC97441.1| NAC protein 11 [Gossypium hirsutum] Length = 291 Score = 75.1 bits (183), Expect = 6e-12 Identities = 38/58 (65%), Positives = 41/58 (70%), Gaps = 2/58 (3%) Frame = +1 Query: 1 NKVS--CLRLPTGNEMLRELQLPKMNMDWTQDSFWTQLCSPWLDNIMLTSPYANILNF 168 NKVS L P GNE L ELQLPK+ DWTQD FWTQL SPW N+ +PYANILNF Sbjct: 237 NKVSPPSLHFPVGNEKLAELQLPKIINDWTQDQFWTQLNSPWFQNL---TPYANILNF 291 >ref|XP_004174070.1| PREDICTED: protein FEZ-like [Cucumis sativus] Length = 155 Score = 62.4 bits (150), Expect = 4e-08 Identities = 27/51 (52%), Positives = 39/51 (76%) Frame = +1 Query: 16 LRLPTGNEMLRELQLPKMNMDWTQDSFWTQLCSPWLDNIMLTSPYANILNF 168 L++P+ E L ELQ+PK++MDW+QD FWTQ SPWL + +P+A++LNF Sbjct: 108 LQIPSELEKLTELQVPKLDMDWSQDLFWTQFNSPWLQTL---TPFASMLNF 155 >ref|XP_004144879.1| PREDICTED: protein FEZ-like [Cucumis sativus] gi|449471534|ref|XP_004153337.1| PREDICTED: protein FEZ-like [Cucumis sativus] Length = 283 Score = 62.4 bits (150), Expect = 4e-08 Identities = 27/51 (52%), Positives = 39/51 (76%) Frame = +1 Query: 16 LRLPTGNEMLRELQLPKMNMDWTQDSFWTQLCSPWLDNIMLTSPYANILNF 168 L++P+ E L ELQ+PK++MDW+QD FWTQ SPWL + +P+A++LNF Sbjct: 236 LQIPSELEKLTELQVPKLDMDWSQDLFWTQFNSPWLQTL---TPFASMLNF 283 >ref|XP_004154545.1| PREDICTED: NAC domain-containing protein 19-like isoform 2 [Cucumis sativus] Length = 303 Score = 62.0 bits (149), Expect = 5e-08 Identities = 30/51 (58%), Positives = 37/51 (72%) Frame = +1 Query: 16 LRLPTGNEMLRELQLPKMNMDWTQDSFWTQLCSPWLDNIMLTSPYANILNF 168 +++P G ML +LQ+PKM MDWTQD FW Q SPWL N T+P +NILNF Sbjct: 256 IQIPKGFGMLTDLQVPKMTMDWTQDQFWNQFNSPWLLN--FTTP-SNILNF 303 >ref|XP_004154544.1| PREDICTED: NAC domain-containing protein 19-like isoform 1 [Cucumis sativus] Length = 323 Score = 62.0 bits (149), Expect = 5e-08 Identities = 30/51 (58%), Positives = 37/51 (72%) Frame = +1 Query: 16 LRLPTGNEMLRELQLPKMNMDWTQDSFWTQLCSPWLDNIMLTSPYANILNF 168 +++P G ML +LQ+PKM MDWTQD FW Q SPWL N T+P +NILNF Sbjct: 276 IQIPKGFGMLTDLQVPKMTMDWTQDQFWNQFNSPWLLN--FTTP-SNILNF 323