BLASTX nr result
ID: Atractylodes22_contig00050081
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00050081 (205 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003523006.1| PREDICTED: LON peptidase N-terminal domain a... 83 3e-14 ref|XP_004138180.1| PREDICTED: LON peptidase N-terminal domain a... 82 3e-14 ref|XP_003527093.1| PREDICTED: LON peptidase N-terminal domain a... 80 1e-13 ref|XP_002284678.2| PREDICTED: probable receptor-like protein ki... 80 2e-13 emb|CBI15185.3| unnamed protein product [Vitis vinifera] 80 2e-13 >ref|XP_003523006.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein 1-like [Glycine max] Length = 486 Score = 82.8 bits (203), Expect = 3e-14 Identities = 41/65 (63%), Positives = 47/65 (72%) Frame = +3 Query: 3 WIRVAQEEAQGDQTRLTELQKAEGYMPSTKDPESFSFWLATLTNWRPRERLDLLRITDTK 182 WI A+E A+ DQ +L L E MPS KDPE FSFWLATL+N RP ERLDLLRI DT Sbjct: 407 WIARAKEAARHDQRKLERLASVEVMMPSPKDPERFSFWLATLSNRRPAERLDLLRIRDTA 466 Query: 183 ERLKR 197 ER++R Sbjct: 467 ERIRR 471 >ref|XP_004138180.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein 2-like [Cucumis sativus] gi|449477199|ref|XP_004154958.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein 2-like [Cucumis sativus] Length = 487 Score = 82.4 bits (202), Expect = 3e-14 Identities = 38/65 (58%), Positives = 50/65 (76%) Frame = +3 Query: 3 WIRVAQEEAQGDQTRLTELQKAEGYMPSTKDPESFSFWLATLTNWRPRERLDLLRITDTK 182 WIR A+E ++ DQ + L E MPS++DPE FSFWLATL+N RP ERL+LLR+TDT+ Sbjct: 408 WIRRAKEASRRDQIKRDRLLNVEAMMPSSRDPERFSFWLATLSNRRPLERLELLRMTDTR 467 Query: 183 ERLKR 197 ER++R Sbjct: 468 ERIRR 472 >ref|XP_003527093.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein 1-like [Glycine max] Length = 486 Score = 80.5 bits (197), Expect = 1e-13 Identities = 40/65 (61%), Positives = 46/65 (70%) Frame = +3 Query: 3 WIRVAQEEAQGDQTRLTELQKAEGYMPSTKDPESFSFWLATLTNWRPRERLDLLRITDTK 182 WI A+E A+ D +L L E MPS KDPE FSFWLATL+N RP ERLDLLRI DT Sbjct: 407 WIARAKEAAKHDPRKLERLASVEVMMPSPKDPERFSFWLATLSNRRPAERLDLLRIRDTA 466 Query: 183 ERLKR 197 ER++R Sbjct: 467 ERIRR 471 >ref|XP_002284678.2| PREDICTED: probable receptor-like protein kinase At5g61350 [Vitis vinifera] Length = 1383 Score = 79.7 bits (195), Expect = 2e-13 Identities = 40/65 (61%), Positives = 48/65 (73%) Frame = +3 Query: 3 WIRVAQEEAQGDQTRLTELQKAEGYMPSTKDPESFSFWLATLTNWRPRERLDLLRITDTK 182 WI+ A+E A D+ RL EL AE MP+ +DPE FSFWLA L+N RP ERLDLL I DTK Sbjct: 403 WIKRAKEAAWQDRRRLAELCHAEAMMPTPQDPELFSFWLAGLSNRRPPERLDLLYIRDTK 462 Query: 183 ERLKR 197 ER++R Sbjct: 463 ERIRR 467 >emb|CBI15185.3| unnamed protein product [Vitis vinifera] Length = 486 Score = 79.7 bits (195), Expect = 2e-13 Identities = 40/65 (61%), Positives = 48/65 (73%) Frame = +3 Query: 3 WIRVAQEEAQGDQTRLTELQKAEGYMPSTKDPESFSFWLATLTNWRPRERLDLLRITDTK 182 WI+ A+E A D+ RL EL AE MP+ +DPE FSFWLA L+N RP ERLDLL I DTK Sbjct: 407 WIKRAKEAAWQDRRRLAELCHAEAMMPTPQDPELFSFWLAGLSNRRPPERLDLLYIRDTK 466 Query: 183 ERLKR 197 ER++R Sbjct: 467 ERIRR 471