BLASTX nr result
ID: Atractylodes22_contig00049996
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00049996 (322 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_004429259.1| putative capsid protein [Fig cryptic virus] ... 69 3e-10 >ref|YP_004429259.1| putative capsid protein [Fig cryptic virus] gi|332163671|emb|CBW77437.1| putative capsid protein [Fig cryptic virus] Length = 337 Score = 69.3 bits (168), Expect = 3e-10 Identities = 33/72 (45%), Positives = 46/72 (63%) Frame = +3 Query: 96 YNRLRDVLQLYAPTEFIARMNPRSPLSNRYKFPAFISSVLSSIGPLRIMDGPEDMVVVYA 275 YNRLR V + + +RMN R+P+SNR +FP+F+SS+L SI LRI DGP D + ++ Sbjct: 88 YNRLRSVAECFHHPTRTSRMNTRAPISNRMEFPSFLSSMLESISWLRINDGPVDYLALFT 147 Query: 276 TSANRSRTYGRA 311 S YGR+ Sbjct: 148 APTGTSNNYGRS 159