BLASTX nr result
ID: Atractylodes22_contig00049839
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00049839 (327 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002523885.1| conserved hypothetical protein [Ricinus comm... 99 5e-19 ref|YP_007474773.1| hypothetical chloroplast RF2 (chloroplast) [... 96 5e-19 ref|YP_007353810.1| hypothetical chloroplast RF2 (chloroplast) [... 96 5e-19 gb|AEX99575.1| hypothetical chloroplast RF2 (chloroplast) [Chrys... 96 5e-19 ref|YP_007353827.1| hypothetical chloroplast RF2 (chloroplast) [... 96 5e-19 >ref|XP_002523885.1| conserved hypothetical protein [Ricinus communis] gi|223536815|gb|EEF38454.1| conserved hypothetical protein [Ricinus communis] Length = 206 Score = 98.6 bits (244), Expect = 5e-19 Identities = 50/81 (61%), Positives = 59/81 (72%), Gaps = 3/81 (3%) Frame = +3 Query: 21 EDDLFNHIVWAPRIGHLSGYLFDCIKNPNELEFPY*SRSFWGKQIICDEEDEVQDNDLEF 200 E+DLFNHIVWAPRI G+LFDCI+ PNELEFPY +RSF GK+IIC++EDE+Q+ND EF Sbjct: 126 EEDLFNHIVWAPRIWRPWGFLFDCIERPNELEFPYWARSFPGKRIICNKEDELQENDSEF 185 Query: 201 F---AE*IHAVPNSPKEQGLS 254 A S KEQG S Sbjct: 186 LQSGAMQYQIRDRSSKEQGFS 206 >ref|YP_007474773.1| hypothetical chloroplast RF2 (chloroplast) [Chrysanthemum indicum] gi|452849111|ref|YP_007474789.1| hypothetical chloroplast RF2 (chloroplast) [Chrysanthemum indicum] gi|372863250|gb|AEX99322.1| hypothetical chloroplast RF2 (chloroplast) [Chrysanthemum indicum] gi|372863266|gb|AEX99338.1| hypothetical chloroplast RF2 (chloroplast) [Chrysanthemum indicum] gi|372863489|gb|AEX99558.1| hypothetical chloroplast RF2 (chloroplast) [Chrysanthemum indicum] Length = 2291 Score = 95.9 bits (237), Expect(2) = 5e-19 Identities = 50/80 (62%), Positives = 56/80 (70%), Gaps = 3/80 (3%) Frame = +3 Query: 21 EDDLFNHIVWAPRIGHLSGYLFDCIKNPNELEFPY*SRSFWGKQIICDEEDEVQDNDLEF 200 E+DLFNHIVWAPRI G+LFDCI+ PNEL FPY SRSF GK+II DEEDE+Q+ND EF Sbjct: 2062 EEDLFNHIVWAPRIWRPWGFLFDCIERPNELGFPYWSRSFRGKRIIYDEEDELQENDSEF 2121 Query: 201 FAE---*IHAVPNSPKEQGL 251 S KEQGL Sbjct: 2122 LQSGTVQYQTRDRSSKEQGL 2141 Score = 23.1 bits (48), Expect(2) = 5e-19 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +2 Query: 254 QLIQLIRNATDPILFLFEAQ 313 ++ Q I + DP+ FLF+AQ Sbjct: 2143 RISQFIWDPADPLFFLFKAQ 2162 >ref|YP_007353810.1| hypothetical chloroplast RF2 (chloroplast) [Chrysanthemum x morifolium] gi|375298880|gb|AFA45319.1| hypothetical chloroplast RF2 (chloroplast) [Chrysanthemum x morifolium] Length = 2291 Score = 95.9 bits (237), Expect(2) = 5e-19 Identities = 50/80 (62%), Positives = 56/80 (70%), Gaps = 3/80 (3%) Frame = +3 Query: 21 EDDLFNHIVWAPRIGHLSGYLFDCIKNPNELEFPY*SRSFWGKQIICDEEDEVQDNDLEF 200 E+DLFNHIVWAPRI G+LFDCI+ PNEL FPY SRSF GK+II DEEDE+Q+ND EF Sbjct: 2062 EEDLFNHIVWAPRIWRPWGFLFDCIERPNELGFPYWSRSFRGKRIIYDEEDELQENDSEF 2121 Query: 201 FAE---*IHAVPNSPKEQGL 251 S KEQGL Sbjct: 2122 LQSGTVQYQTRDRSSKEQGL 2141 Score = 23.1 bits (48), Expect(2) = 5e-19 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +2 Query: 254 QLIQLIRNATDPILFLFEAQ 313 ++ Q I + DP+ FLF+AQ Sbjct: 2143 RISQFIWDPADPLFFLFKAQ 2162 >gb|AEX99575.1| hypothetical chloroplast RF2 (chloroplast) [Chrysanthemum indicum] Length = 2282 Score = 95.9 bits (237), Expect(2) = 5e-19 Identities = 50/80 (62%), Positives = 56/80 (70%), Gaps = 3/80 (3%) Frame = +3 Query: 21 EDDLFNHIVWAPRIGHLSGYLFDCIKNPNELEFPY*SRSFWGKQIICDEEDEVQDNDLEF 200 E+DLFNHIVWAPRI G+LFDCI+ PNEL FPY SRSF GK+II DEEDE+Q+ND EF Sbjct: 2053 EEDLFNHIVWAPRIWRPWGFLFDCIERPNELGFPYWSRSFRGKRIIYDEEDELQENDSEF 2112 Query: 201 FAE---*IHAVPNSPKEQGL 251 S KEQGL Sbjct: 2113 LQSGTVQYQTRDRSSKEQGL 2132 Score = 23.1 bits (48), Expect(2) = 5e-19 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +2 Query: 254 QLIQLIRNATDPILFLFEAQ 313 ++ Q I + DP+ FLF+AQ Sbjct: 2134 RISQFIWDPADPLFFLFKAQ 2153 >ref|YP_007353827.1| hypothetical chloroplast RF2 (chloroplast) [Chrysanthemum x morifolium] gi|375298897|gb|AFA45336.1| hypothetical chloroplast RF2 (chloroplast) [Chrysanthemum x morifolium] Length = 2282 Score = 95.9 bits (237), Expect(2) = 5e-19 Identities = 50/80 (62%), Positives = 56/80 (70%), Gaps = 3/80 (3%) Frame = +3 Query: 21 EDDLFNHIVWAPRIGHLSGYLFDCIKNPNELEFPY*SRSFWGKQIICDEEDEVQDNDLEF 200 E+DLFNHIVWAPRI G+LFDCI+ PNEL FPY SRSF GK+II DEEDE+Q+ND EF Sbjct: 2053 EEDLFNHIVWAPRIWRPWGFLFDCIERPNELGFPYWSRSFRGKRIIYDEEDELQENDSEF 2112 Query: 201 FAE---*IHAVPNSPKEQGL 251 S KEQGL Sbjct: 2113 LQSGTVQYQTRDRSSKEQGL 2132 Score = 23.1 bits (48), Expect(2) = 5e-19 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +2 Query: 254 QLIQLIRNATDPILFLFEAQ 313 ++ Q I + DP+ FLF+AQ Sbjct: 2134 RISQFIWDPADPLFFLFKAQ 2153