BLASTX nr result
ID: Atractylodes22_contig00049711
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00049711 (292 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515674.1| hypothetical protein RCOM_1379210 [Ricinus c... 99 4e-19 ref|XP_002523157.1| Reticuline oxidase precursor, putative [Rici... 99 4e-19 ref|XP_002523158.1| Reticuline oxidase precursor, putative [Rici... 99 5e-19 gb|AEK87147.1| berberine bridge enzyme [Hevea brasiliensis] 96 2e-18 ref|XP_003594610.1| Reticuline oxidase-like protein [Medicago tr... 96 4e-18 >ref|XP_002515674.1| hypothetical protein RCOM_1379210 [Ricinus communis] gi|223545217|gb|EEF46726.1| hypothetical protein RCOM_1379210 [Ricinus communis] Length = 75 Score = 99.0 bits (245), Expect = 4e-19 Identities = 48/64 (75%), Positives = 53/64 (82%) Frame = -1 Query: 292 AFLNYRDLDIGVMTGSGKSGYNSGKVYGEKYFMGNFMRLVKVKTAVDPDNFFRNEQSIPI 113 AFLNYRDLDIGVMT GK+ Y G +YG KYF GNF RLVKVKTAVDP+NFFRNEQSIP Sbjct: 12 AFLNYRDLDIGVMT-PGKNSYEEGSIYGYKYFNGNFDRLVKVKTAVDPENFFRNEQSIPT 70 Query: 112 MAGK 101 ++ K Sbjct: 71 LSSK 74 >ref|XP_002523157.1| Reticuline oxidase precursor, putative [Ricinus communis] gi|223537564|gb|EEF39188.1| Reticuline oxidase precursor, putative [Ricinus communis] Length = 539 Score = 99.0 bits (245), Expect = 4e-19 Identities = 48/64 (75%), Positives = 53/64 (82%) Frame = -1 Query: 292 AFLNYRDLDIGVMTGSGKSGYNSGKVYGEKYFMGNFMRLVKVKTAVDPDNFFRNEQSIPI 113 AFLNYRDLDIGVMT GK+ Y G +YG KYF GNF RLVKVKTAVDP+NFFRNEQSIP Sbjct: 476 AFLNYRDLDIGVMT-PGKNSYEEGSIYGYKYFNGNFDRLVKVKTAVDPENFFRNEQSIPT 534 Query: 112 MAGK 101 ++ K Sbjct: 535 LSSK 538 >ref|XP_002523158.1| Reticuline oxidase precursor, putative [Ricinus communis] gi|223537565|gb|EEF39189.1| Reticuline oxidase precursor, putative [Ricinus communis] Length = 539 Score = 98.6 bits (244), Expect = 5e-19 Identities = 48/64 (75%), Positives = 53/64 (82%) Frame = -1 Query: 292 AFLNYRDLDIGVMTGSGKSGYNSGKVYGEKYFMGNFMRLVKVKTAVDPDNFFRNEQSIPI 113 AFLNYRDLDIGVMT S K+ Y G +YG KYF GNF RLVKVKTAVDP+NFFRNEQSIP Sbjct: 476 AFLNYRDLDIGVMTPS-KNSYEEGSIYGHKYFNGNFDRLVKVKTAVDPENFFRNEQSIPT 534 Query: 112 MAGK 101 ++ K Sbjct: 535 LSSK 538 >gb|AEK87147.1| berberine bridge enzyme [Hevea brasiliensis] Length = 539 Score = 96.3 bits (238), Expect = 2e-18 Identities = 48/64 (75%), Positives = 52/64 (81%) Frame = -1 Query: 292 AFLNYRDLDIGVMTGSGKSGYNSGKVYGEKYFMGNFMRLVKVKTAVDPDNFFRNEQSIPI 113 AFLNYRDLDIGVM +GK+ Y G VYG KYF GNF RLVKVKTAVDP+NFFRNEQSIP Sbjct: 476 AFLNYRDLDIGVME-AGKNSYEEGSVYGYKYFNGNFDRLVKVKTAVDPENFFRNEQSIPT 534 Query: 112 MAGK 101 + K Sbjct: 535 LPTK 538 >ref|XP_003594610.1| Reticuline oxidase-like protein [Medicago truncatula] gi|355483658|gb|AES64861.1| Reticuline oxidase-like protein [Medicago truncatula] Length = 542 Score = 95.5 bits (236), Expect = 4e-18 Identities = 44/64 (68%), Positives = 52/64 (81%) Frame = -1 Query: 292 AFLNYRDLDIGVMTGSGKSGYNSGKVYGEKYFMGNFMRLVKVKTAVDPDNFFRNEQSIPI 113 A++NYRDLDIG+ GK+ Y G+VYG KYF NF RLVK+KTAVDPDNFFRNEQSIP+ Sbjct: 479 AYINYRDLDIGI-NSFGKNSYEEGEVYGTKYFNNNFDRLVKIKTAVDPDNFFRNEQSIPV 537 Query: 112 MAGK 101 + GK Sbjct: 538 LPGK 541