BLASTX nr result
ID: Atractylodes22_contig00049592
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00049592 (302 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAB33151.1| hypothetical protein [Carthamus tinctorius] 79 5e-13 >dbj|BAB33151.1| hypothetical protein [Carthamus tinctorius] Length = 699 Score = 78.6 bits (192), Expect = 5e-13 Identities = 37/101 (36%), Positives = 59/101 (58%), Gaps = 2/101 (1%) Frame = -3 Query: 297 INQCLNEQWNDDDMLESILEQVRVIRENARKAAPQGAESSTKKDIIKELFGVSPPDNVQI 118 +++ + N+ D+LE ++E++ + E + P + KK+ I+E GV D+ + Sbjct: 588 VDRMIGRVRNEKDVLERVVEKLENMDEELDEVVPLKSSRERKKEAIREFVGVPESDDNDV 647 Query: 117 QPPKGIRNKGCGKGKRLIGPGEKA--KTAKPPRLCRACGEY 1 PP GIRNKGCG+GKRL G E+ + KP RLCR C ++ Sbjct: 648 LPPSGIRNKGCGRGKRLKGVRERVDEEAKKPKRLCRTCNDF 688