BLASTX nr result
ID: Atractylodes22_contig00049518
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00049518 (249 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN70361.1| hypothetical protein VITISV_033646 [Vitis vinifera] 60 2e-07 emb|CAN69647.1| hypothetical protein VITISV_022133 [Vitis vinifera] 57 2e-06 emb|CAN62394.1| hypothetical protein VITISV_021305 [Vitis vinifera] 57 2e-06 emb|CAN75041.1| hypothetical protein VITISV_027174 [Vitis vinifera] 57 2e-06 emb|CAN61815.1| hypothetical protein VITISV_009920 [Vitis vinifera] 57 2e-06 >emb|CAN70361.1| hypothetical protein VITISV_033646 [Vitis vinifera] Length = 1013 Score = 59.7 bits (143), Expect = 2e-07 Identities = 27/48 (56%), Positives = 35/48 (72%) Frame = +1 Query: 1 EHTKLKPRSRLRCFIGYDIEHKGYQFWYPVSQRFCVSHHVIFREDQMF 144 EH KL+PRSRL CF+GY KGY+ + PVS R VSH+V+F E ++F Sbjct: 411 EHNKLEPRSRLCCFLGYGETQKGYRCYDPVSHRLRVSHNVVFWEHRLF 458 >emb|CAN69647.1| hypothetical protein VITISV_022133 [Vitis vinifera] Length = 2655 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/48 (54%), Positives = 34/48 (70%) Frame = +1 Query: 1 EHTKLKPRSRLRCFIGYDIEHKGYQFWYPVSQRFCVSHHVIFREDQMF 144 EH KL+PRSRL CF+GY KGY+ + PVS R VS +V+F E ++F Sbjct: 2011 EHNKLEPRSRLCCFLGYGETQKGYRCYDPVSHRLHVSRNVVFWEHRLF 2058 >emb|CAN62394.1| hypothetical protein VITISV_021305 [Vitis vinifera] Length = 1287 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/48 (54%), Positives = 34/48 (70%) Frame = +1 Query: 1 EHTKLKPRSRLRCFIGYDIEHKGYQFWYPVSQRFCVSHHVIFREDQMF 144 EH KL+PRSRL CF+GY KGY+ + PVS R VS +V+F E ++F Sbjct: 687 EHNKLEPRSRLCCFLGYGETQKGYRCYDPVSHRLRVSRNVVFWEHRLF 734 >emb|CAN75041.1| hypothetical protein VITISV_027174 [Vitis vinifera] Length = 1381 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/48 (54%), Positives = 34/48 (70%) Frame = +1 Query: 1 EHTKLKPRSRLRCFIGYDIEHKGYQFWYPVSQRFCVSHHVIFREDQMF 144 EH KL+PRSRL CF+GY KGY+ + PVS R VS +V+F E ++F Sbjct: 720 EHNKLEPRSRLCCFLGYGETQKGYRCYDPVSHRLRVSRNVVFWEHRLF 767 >emb|CAN61815.1| hypothetical protein VITISV_009920 [Vitis vinifera] Length = 1064 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/48 (54%), Positives = 34/48 (70%) Frame = +1 Query: 1 EHTKLKPRSRLRCFIGYDIEHKGYQFWYPVSQRFCVSHHVIFREDQMF 144 EH KL+ RSRL CF+GY KGY+ + PVS R VSH+V+F E ++F Sbjct: 491 EHNKLESRSRLCCFLGYGETQKGYRCYDPVSHRLRVSHNVVFWEHRLF 538