BLASTX nr result
ID: Atractylodes22_contig00049363
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00049363 (371 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527480.1| conserved hypothetical protein [Ricinus comm... 55 6e-06 >ref|XP_002527480.1| conserved hypothetical protein [Ricinus communis] gi|223533120|gb|EEF34878.1| conserved hypothetical protein [Ricinus communis] Length = 379 Score = 55.1 bits (131), Expect = 6e-06 Identities = 31/104 (29%), Positives = 56/104 (53%), Gaps = 4/104 (3%) Frame = -2 Query: 337 VVVWNPSIRKSVAIDMPDLSY---GTVLGFGVSPVTSDPTIVKFDNFNQLWETKTKIKKL 167 +V+WNPSI SV + + +SY VLGFG T+D +++ ++ + + Sbjct: 122 IVLWNPSIGLSVTLPLQRISYKVSNVVLGFGFDSRTNDYKVIRI-----VYYSTNDDSLM 176 Query: 166 IPCKVRVYTLSSGEWR-TPSCNLPRPSIEVTWSQVVIDRFIYWL 38 +P +V ++ LS G WR S ++P + SQ+V++ I+W+ Sbjct: 177 VPPEVEIFELSRGTWRINNSASVPAYDVSKYSSQIVLEGAIHWV 220