BLASTX nr result
ID: Atractylodes22_contig00049250
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00049250 (246 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI25355.3| unnamed protein product [Vitis vinifera] 59 4e-07 ref|XP_002275231.1| PREDICTED: uncharacterized protein LOC100267... 59 4e-07 >emb|CBI25355.3| unnamed protein product [Vitis vinifera] Length = 559 Score = 58.9 bits (141), Expect = 4e-07 Identities = 35/71 (49%), Positives = 39/71 (54%), Gaps = 3/71 (4%) Frame = +2 Query: 41 LDLNAK---SNHLPMDDAPSCIEDTNKLRFLGKPQETESTKFCGKPRSFGLDLNSEDVSS 211 LDLNAK + L D +C+E NKL L K F R GLDLNSEDV S Sbjct: 99 LDLNAKVCSARKLACDVTSACVEGNNKLHPLTKHDMEHDPNFVTS-RGIGLDLNSEDVCS 157 Query: 212 SINHDPFYLYK 244 S+N DPFY YK Sbjct: 158 SVNQDPFYSYK 168 >ref|XP_002275231.1| PREDICTED: uncharacterized protein LOC100267305 [Vitis vinifera] Length = 616 Score = 58.9 bits (141), Expect = 4e-07 Identities = 35/71 (49%), Positives = 39/71 (54%), Gaps = 3/71 (4%) Frame = +2 Query: 41 LDLNAK---SNHLPMDDAPSCIEDTNKLRFLGKPQETESTKFCGKPRSFGLDLNSEDVSS 211 LDLNAK + L D +C+E NKL L K F R GLDLNSEDV S Sbjct: 112 LDLNAKVCSARKLACDVTSACVEGNNKLHPLTKHDMEHDPNFVTS-RGIGLDLNSEDVCS 170 Query: 212 SINHDPFYLYK 244 S+N DPFY YK Sbjct: 171 SVNQDPFYSYK 181