BLASTX nr result
ID: Atractylodes22_contig00048986
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00048986 (407 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003537180.1| PREDICTED: multiple C2 and transmembrane dom... 58 9e-07 ref|XP_004150160.1| PREDICTED: multiple C2 and transmembrane dom... 57 1e-06 ref|XP_002277970.2| PREDICTED: multiple C2 and transmembrane dom... 57 2e-06 ref|XP_003635987.1| Multiple C2 and transmembrane domain-contain... 57 2e-06 ref|XP_002330999.1| predicted protein [Populus trichocarpa] gi|2... 57 2e-06 >ref|XP_003537180.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 2-like [Glycine max] Length = 797 Score = 57.8 bits (138), Expect = 9e-07 Identities = 28/47 (59%), Positives = 33/47 (70%), Gaps = 2/47 (4%) Frame = -3 Query: 135 MSSKPAA--GNPDDYKIKDTKPQLGERWPHXXXXXXXGWISSDRVTS 1 MSS AA GN +DYK+KDTKP+LGE+WPH GWI S+R TS Sbjct: 1 MSSSQAAAKGNQEDYKLKDTKPELGEKWPHGGQRGGSGWIYSERATS 47 >ref|XP_004150160.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 2-like [Cucumis sativus] gi|449476358|ref|XP_004154715.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 2-like [Cucumis sativus] Length = 789 Score = 57.4 bits (137), Expect = 1e-06 Identities = 27/44 (61%), Positives = 32/44 (72%), Gaps = 1/44 (2%) Frame = -3 Query: 129 SKPAAGNPD-DYKIKDTKPQLGERWPHXXXXXXXGWISSDRVTS 1 S PAAG+ + DYK+KDTKP LGERWPH GWI+S+R TS Sbjct: 2 SSPAAGDKEADYKLKDTKPNLGERWPHGGIRGGGGWITSERATS 45 >ref|XP_002277970.2| PREDICTED: multiple C2 and transmembrane domain-containing protein 2-like [Vitis vinifera] Length = 794 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/40 (62%), Positives = 30/40 (75%) Frame = -3 Query: 120 AAGNPDDYKIKDTKPQLGERWPHXXXXXXXGWISSDRVTS 1 ++ + +DYK+KDT PQLGERWPH GWISSDRVTS Sbjct: 4 SSNHQEDYKLKDTHPQLGERWPHGGVRGGGGWISSDRVTS 43 >ref|XP_003635987.1| Multiple C2 and transmembrane domain-containing protein [Medicago truncatula] gi|355501922|gb|AES83125.1| Multiple C2 and transmembrane domain-containing protein [Medicago truncatula] Length = 1370 Score = 57.0 bits (136), Expect = 2e-06 Identities = 27/45 (60%), Positives = 32/45 (71%), Gaps = 1/45 (2%) Frame = -3 Query: 132 SSKPAAG-NPDDYKIKDTKPQLGERWPHXXXXXXXGWISSDRVTS 1 SSKPA N DDYK+KDTKP+LGE+WPH GW+ S+R TS Sbjct: 3 SSKPAPKPNTDDYKLKDTKPELGEKWPHGGQRGGTGWLYSERATS 47 >ref|XP_002330999.1| predicted protein [Populus trichocarpa] gi|222872929|gb|EEF10060.1| predicted protein [Populus trichocarpa] Length = 796 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/45 (57%), Positives = 31/45 (68%) Frame = -3 Query: 135 MSSKPAAGNPDDYKIKDTKPQLGERWPHXXXXXXXGWISSDRVTS 1 M+ A + DD+K+KDTKPQLGERWPH GWISS+R TS Sbjct: 1 MNPLAAPDHKDDFKLKDTKPQLGERWPHGGPRGGGGWISSERATS 45