BLASTX nr result
ID: Atractylodes22_contig00048799
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00048799 (245 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_197550.1| glutaredoxin-C4 [Arabidopsis thaliana] gi|11937... 76 3e-12 gb|AAM61279.1| glutaredoxin [Arabidopsis thaliana] 76 3e-12 ref|XP_002871942.1| hypothetical protein ARALYDRAFT_910087 [Arab... 74 9e-12 ref|XP_002325236.1| glutaredoxin C4 [Populus trichocarpa] gi|118... 70 2e-10 gb|AAL90750.1| glutaredoxin [Populus tremula x Populus tremuloides] 69 5e-10 >ref|NP_197550.1| glutaredoxin-C4 [Arabidopsis thaliana] gi|119370637|sp|Q8LFQ6.2|GRXC4_ARATH RecName: Full=Glutaredoxin-C4; Short=AtGrxC4 gi|6735386|emb|CAB69043.1| glutaredoxin [Arabidopsis thaliana] gi|25082927|gb|AAN72016.1| glutaredoxin [Arabidopsis thaliana] gi|25082941|gb|AAN72019.1| glutaredoxin [Arabidopsis thaliana] gi|98960865|gb|ABF58916.1| At5g20500 [Arabidopsis thaliana] gi|332005470|gb|AED92853.1| glutaredoxin-C4 [Arabidopsis thaliana] Length = 135 Score = 75.9 bits (185), Expect = 3e-12 Identities = 35/50 (70%), Positives = 44/50 (88%) Frame = -1 Query: 245 ALGDVVGRRTVPQVFVNGKHIGGSVDTVIAYKNGELAMLIGVDSSVKAEL 96 ALG++VGRRTVPQVF+NGKH+GGS DTV AY++GELA L+GV + +AEL Sbjct: 86 ALGEIVGRRTVPQVFINGKHLGGSDDTVDAYESGELAKLLGVSGNKEAEL 135 >gb|AAM61279.1| glutaredoxin [Arabidopsis thaliana] Length = 135 Score = 75.9 bits (185), Expect = 3e-12 Identities = 35/50 (70%), Positives = 44/50 (88%) Frame = -1 Query: 245 ALGDVVGRRTVPQVFVNGKHIGGSVDTVIAYKNGELAMLIGVDSSVKAEL 96 ALG++VGRRTVPQVF+NGKH+GGS DTV AY++GELA L+GV + +AEL Sbjct: 86 ALGEIVGRRTVPQVFINGKHLGGSDDTVDAYESGELAKLLGVSGNKEAEL 135 >ref|XP_002871942.1| hypothetical protein ARALYDRAFT_910087 [Arabidopsis lyrata subsp. lyrata] gi|297317779|gb|EFH48201.1| hypothetical protein ARALYDRAFT_910087 [Arabidopsis lyrata subsp. lyrata] Length = 132 Score = 74.3 bits (181), Expect = 9e-12 Identities = 35/50 (70%), Positives = 43/50 (86%) Frame = -1 Query: 245 ALGDVVGRRTVPQVFVNGKHIGGSVDTVIAYKNGELAMLIGVDSSVKAEL 96 ALG++VGRRTVPQVF++GKHIGGS DTV AY++GELA L+GV + AEL Sbjct: 83 ALGEIVGRRTVPQVFIDGKHIGGSDDTVDAYESGELAKLLGVSGNKNAEL 132 >ref|XP_002325236.1| glutaredoxin C4 [Populus trichocarpa] gi|118483557|gb|ABK93676.1| unknown [Populus trichocarpa] gi|118488597|gb|ABK96111.1| unknown [Populus trichocarpa] gi|222866670|gb|EEF03801.1| glutaredoxin C4 [Populus trichocarpa] Length = 136 Score = 70.1 bits (170), Expect = 2e-10 Identities = 33/50 (66%), Positives = 42/50 (84%) Frame = -1 Query: 245 ALGDVVGRRTVPQVFVNGKHIGGSVDTVIAYKNGELAMLIGVDSSVKAEL 96 A+ ++VGRRTVPQVF++GKHIGGS DTV AY++GELA L+GV S K +L Sbjct: 87 AMSEIVGRRTVPQVFIDGKHIGGSDDTVEAYESGELAKLLGVASEQKDDL 136 >gb|AAL90750.1| glutaredoxin [Populus tremula x Populus tremuloides] Length = 139 Score = 68.6 bits (166), Expect = 5e-10 Identities = 32/47 (68%), Positives = 40/47 (85%) Frame = -1 Query: 245 ALGDVVGRRTVPQVFVNGKHIGGSVDTVIAYKNGELAMLIGVDSSVK 105 A+ ++VGRRTVPQVF++GKHIGGS DTV AY++GELA L+GV S K Sbjct: 87 AMSEIVGRRTVPQVFIDGKHIGGSDDTVEAYESGELAKLLGVASEQK 133