BLASTX nr result
ID: Atractylodes22_contig00048561
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00048561 (322 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN75149.1| hypothetical protein VITISV_027193 [Vitis vinifera] 48 2e-06 >emb|CAN75149.1| hypothetical protein VITISV_027193 [Vitis vinifera] Length = 587 Score = 48.1 bits (113), Expect(2) = 2e-06 Identities = 21/26 (80%), Positives = 23/26 (88%) Frame = +2 Query: 95 IVGTLQYVTLSRPDIAFAVNKVCQFM 172 IVG LQYVT +RPDIAF+VNK CQFM Sbjct: 519 IVGALQYVTFTRPDIAFSVNKACQFM 544 Score = 28.1 bits (61), Expect(2) = 2e-06 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +3 Query: 6 SKPTPSSMTVSSPLCLSDSAAFSDPVKYCRLL 101 +KPTP+ ++ L SD DP KY R++ Sbjct: 489 AKPTPTPYSLGPTLSQSDGVPLPDPSKYRRIV 520