BLASTX nr result
ID: Atractylodes22_contig00048317
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00048317 (203 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004142132.1| PREDICTED: uncharacterized protein LOC101208... 55 8e-07 ref|XP_003592474.1| hypothetical protein MTR_1g105390 [Medicago ... 58 9e-07 ref|XP_003537952.1| PREDICTED: uncharacterized protein LOC100788... 57 1e-06 ref|XP_003539398.1| PREDICTED: uncharacterized protein LOC100815... 57 2e-06 gb|ACU19646.1| unknown [Glycine max] 57 2e-06 >ref|XP_004142132.1| PREDICTED: uncharacterized protein LOC101208319 [Cucumis sativus] gi|449520803|ref|XP_004167422.1| PREDICTED: uncharacterized protein LOC101231623 [Cucumis sativus] Length = 483 Score = 55.5 bits (132), Expect(2) = 8e-07 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = +2 Query: 2 DTISLSQKLSLHRHTKVPISLHVFAWDQEV 91 DT+SLSQKLSLHRH KVPI LHVF WD+E+ Sbjct: 368 DTVSLSQKLSLHRHAKVPIFLHVFLWDREL 397 Score = 22.3 bits (46), Expect(2) = 8e-07 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +1 Query: 97 VRQRQPQAQTNPPIAMSLPVETQTTQIAKRPD 192 +RQR +Q P ++LP E Q+A++P+ Sbjct: 407 IRQRSTASQPAAPARLALPPE---FQLARQPN 435 >ref|XP_003592474.1| hypothetical protein MTR_1g105390 [Medicago truncatula] gi|355481522|gb|AES62725.1| hypothetical protein MTR_1g105390 [Medicago truncatula] Length = 349 Score = 57.8 bits (138), Expect = 9e-07 Identities = 27/43 (62%), Positives = 32/43 (74%) Frame = +2 Query: 2 DTISLSQKLSLHRHTKVPISLHVFAWDQEVAMLGNANLKLKQI 130 DT+SLSQKLSLHRHTKVPI LHVF WD+ +A + K K + Sbjct: 238 DTVSLSQKLSLHRHTKVPILLHVFLWDRTMATSSAESTKSKPL 280 >ref|XP_003537952.1| PREDICTED: uncharacterized protein LOC100788800 [Glycine max] Length = 483 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +2 Query: 2 DTISLSQKLSLHRHTKVPISLHVFAWDQEVA 94 DT+SLSQKLSLHRHTKVPI LHVF WD+++A Sbjct: 377 DTVSLSQKLSLHRHTKVPILLHVFLWDRKLA 407 >ref|XP_003539398.1| PREDICTED: uncharacterized protein LOC100815203 [Glycine max] Length = 487 Score = 56.6 bits (135), Expect = 2e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +2 Query: 2 DTISLSQKLSLHRHTKVPISLHVFAWDQEVA 94 DT+SLSQKLSLHRHTKVPI LHVF WD+ +A Sbjct: 376 DTVSLSQKLSLHRHTKVPILLHVFLWDRTLA 406 >gb|ACU19646.1| unknown [Glycine max] Length = 487 Score = 56.6 bits (135), Expect = 2e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +2 Query: 2 DTISLSQKLSLHRHTKVPISLHVFAWDQEVA 94 DT+SLSQKLSLHRHTKVPI LHVF WD+ +A Sbjct: 376 DTVSLSQKLSLHRHTKVPIFLHVFLWDRTLA 406