BLASTX nr result
ID: Atractylodes22_contig00048303
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00048303 (531 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531032.1| pentatricopeptide repeat-containing protein,... 83 2e-14 ref|XP_003540576.1| PREDICTED: pentatricopeptide repeat-containi... 72 4e-11 ref|XP_003629888.1| Pentatricopeptide repeat protein [Medicago t... 70 1e-10 ref|XP_003603718.1| Pentatricopeptide repeat protein [Medicago t... 69 4e-10 ref|XP_002263755.1| PREDICTED: pentatricopeptide repeat-containi... 66 3e-09 >ref|XP_002531032.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223529385|gb|EEF31349.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 392 Score = 83.2 bits (204), Expect = 2e-14 Identities = 39/59 (66%), Positives = 49/59 (83%) Frame = +2 Query: 299 VELAKHVFEESSYKNVVCCNSLITGCFNNGHVDEARKVFEEMPERNDVSYSAMISGFVK 475 VE A+ VF+ESS NVVC SLI+GC NG +DEAR++F+ MPERN+VSYSAM+SGFV+ Sbjct: 159 VEYARQVFDESSDTNVVCWTSLISGCCINGLIDEAREMFDRMPERNEVSYSAMVSGFVR 217 >ref|XP_003540576.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Glycine max] Length = 522 Score = 72.4 bits (176), Expect = 4e-11 Identities = 34/58 (58%), Positives = 46/58 (79%), Gaps = 2/58 (3%) Frame = +2 Query: 308 AKHVFEESSYKNVVCCNSLITGCFNNGHVDEARKVFEEMP--ERNDVSYSAMISGFVK 475 A+ +F++S YKNV C SL+TG NNG V++AR +F+ +P ERNDVSYSAM+SG+VK Sbjct: 149 ARRLFDQSPYKNVACWTSLVTGYCNNGLVNDARNLFDAIPERERNDVSYSAMVSGYVK 206 >ref|XP_003629888.1| Pentatricopeptide repeat protein [Medicago truncatula] gi|355523910|gb|AET04364.1| Pentatricopeptide repeat protein [Medicago truncatula] Length = 515 Score = 70.5 bits (171), Expect = 1e-10 Identities = 36/82 (43%), Positives = 55/82 (67%) Frame = +2 Query: 230 ASKMFNHGSIFNQVSMPTIRFKVVELAKHVFEESSYKNVVCCNSLITGCFNNGHVDEARK 409 +S ++ S+ N S + + LA+ VF+E S +NVVC SL++G + G V+EAR Sbjct: 117 SSDVYFVSSVINAFS----KHSAIHLARQVFDECSNRNVVCWTSLVSGYCSCGLVNEARD 172 Query: 410 VFEEMPERNDVSYSAMISGFVK 475 VF++MP RN+ SYSAM+SG+V+ Sbjct: 173 VFDKMPLRNEASYSAMVSGYVR 194 >ref|XP_003603718.1| Pentatricopeptide repeat protein [Medicago truncatula] gi|355492766|gb|AES73969.1| Pentatricopeptide repeat protein [Medicago truncatula] Length = 629 Score = 68.9 bits (167), Expect = 4e-10 Identities = 36/85 (42%), Positives = 56/85 (65%) Frame = +2 Query: 221 SSPASKMFNHGSIFNQVSMPTIRFKVVELAKHVFEESSYKNVVCCNSLITGCFNNGHVDE 400 S +S ++ S+ N S + + LA+ VF+ESS +NVVC SL++G + G V+E Sbjct: 150 SGNSSDVYFVSSVINVFS----KHGAIHLARQVFDESSNRNVVCWTSLVSGYCSCGLVNE 205 Query: 401 ARKVFEEMPERNDVSYSAMISGFVK 475 R VF++MP+RN+ S SAM+SG+V+ Sbjct: 206 VRDVFDKMPQRNEASNSAMVSGYVR 230 >ref|XP_002263755.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Vitis vinifera] Length = 624 Score = 66.2 bits (160), Expect = 3e-09 Identities = 35/78 (44%), Positives = 50/78 (64%) Frame = +2 Query: 251 GSIFNQVSMPTIRFKVVELAKHVFEESSYKNVVCCNSLITGCFNNGHVDEARKVFEEMPE 430 G N + + F+ +E A+ VF+ ++VV SLITG G VD+AR+VFE MPE Sbjct: 155 GFSLNNLIHMYVNFQSLEQARRVFDNMPQRDVVSWTSLITGYSQWGFVDKAREVFELMPE 214 Query: 431 RNDVSYSAMISGFVKPNR 484 RN VS++AMI+ +V+ NR Sbjct: 215 RNSVSWNAMIAAYVQSNR 232