BLASTX nr result
ID: Atractylodes22_contig00048297
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00048297 (349 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003622970.1| Pantothenate synthetase [Medicago truncatula... 39 5e-06 >ref|XP_003622970.1| Pantothenate synthetase [Medicago truncatula] gi|355497985|gb|AES79188.1| Pantothenate synthetase [Medicago truncatula] Length = 551 Score = 38.9 bits (89), Expect(2) = 5e-06 Identities = 18/55 (32%), Positives = 36/55 (65%), Gaps = 1/55 (1%) Frame = -1 Query: 166 KVSHQKLMMAWNVVVWTTFYLLWKERNNIVFAKKEIFNSMD-LLFEIQVVSFFWI 5 + + ++L+ + ++ T +L+WKERN +F K F +D ++ EI+V+S+FW+ Sbjct: 345 EATSKRLLKGFRLIWHATIWLIWKERNAKIF--KNQFKEVDEIIDEIKVLSWFWV 397 Score = 36.2 bits (82), Expect(2) = 5e-06 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -3 Query: 320 CPRCGNEQESIYHCFMSCSFSLHVWKGLFQW 228 C CG +ES H F+ C + +W+G+ W Sbjct: 295 CVLCGQREESSTHLFLHCEVAAKIWRGVLNW 325