BLASTX nr result
ID: Atractylodes22_contig00048282
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00048282 (258 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002278429.1| PREDICTED: protein phosphatase 2C 29-like [V... 63 3e-08 emb|CBI33901.3| unnamed protein product [Vitis vinifera] 58 7e-07 >ref|XP_002278429.1| PREDICTED: protein phosphatase 2C 29-like [Vitis vinifera] Length = 822 Score = 62.8 bits (151), Expect = 3e-08 Identities = 31/51 (60%), Positives = 37/51 (72%) Frame = +3 Query: 105 RKTGVESNVMGSGFSQLLPCFNPAAATKRRREQPELIFTPTEPLDETLGHS 257 R+ NVMGSG SQL PCF PA+ T E+PE++FT +EPLDETLGHS Sbjct: 45 RRPAAGVNVMGSGLSQLCPCFVPASRTAV--EEPEVVFTASEPLDETLGHS 93 >emb|CBI33901.3| unnamed protein product [Vitis vinifera] Length = 754 Score = 58.2 bits (139), Expect = 7e-07 Identities = 28/42 (66%), Positives = 33/42 (78%) Frame = +3 Query: 132 MGSGFSQLLPCFNPAAATKRRREQPELIFTPTEPLDETLGHS 257 MGSG SQL PCF PA+ T E+PE++FT +EPLDETLGHS Sbjct: 1 MGSGLSQLCPCFVPASRTAV--EEPEVVFTASEPLDETLGHS 40