BLASTX nr result
ID: Atractylodes22_contig00048127
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00048127 (453 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACJ84945.1| unknown [Medicago truncatula] 61 1e-07 ref|XP_003606834.1| Arginine decarboxylase [Medicago truncatula]... 61 1e-07 ref|XP_003541126.1| PREDICTED: arginine decarboxylase-like [Glyc... 60 2e-07 ref|XP_003606837.1| Arginine decarboxylase [Medicago truncatula]... 59 4e-07 ref|XP_003606835.1| Arginine decarboxylase [Medicago truncatula]... 59 4e-07 >gb|ACJ84945.1| unknown [Medicago truncatula] Length = 257 Score = 60.8 bits (146), Expect = 1e-07 Identities = 28/42 (66%), Positives = 35/42 (83%) Frame = +1 Query: 1 PLLIPGEVMTEEATRYLVEVKNKGGFVSGASDPSLSSIVVCS 126 P+LIPGEV+TE A YL+ V++KG +SGASDP LSSIVVC+ Sbjct: 208 PVLIPGEVITERAVNYLLHVRSKGADISGASDPLLSSIVVCN 249 >ref|XP_003606834.1| Arginine decarboxylase [Medicago truncatula] gi|355507889|gb|AES89031.1| Arginine decarboxylase [Medicago truncatula] Length = 577 Score = 60.8 bits (146), Expect = 1e-07 Identities = 28/42 (66%), Positives = 35/42 (83%) Frame = +1 Query: 1 PLLIPGEVMTEEATRYLVEVKNKGGFVSGASDPSLSSIVVCS 126 P+LIPGEV+TE A YL+ V++KG +SGASDP LSSIVVC+ Sbjct: 528 PVLIPGEVITERAVNYLLHVRSKGADISGASDPLLSSIVVCN 569 >ref|XP_003541126.1| PREDICTED: arginine decarboxylase-like [Glycine max] Length = 560 Score = 60.1 bits (144), Expect = 2e-07 Identities = 27/42 (64%), Positives = 37/42 (88%) Frame = +1 Query: 1 PLLIPGEVMTEEATRYLVEVKNKGGFVSGASDPSLSSIVVCS 126 P+LIPGEV+T++A YL+ V++KGG ++GASDP LSSIVVC+ Sbjct: 518 PVLIPGEVITKKAVDYLLHVRSKGGDITGASDPLLSSIVVCN 559 >ref|XP_003606837.1| Arginine decarboxylase [Medicago truncatula] gi|355507892|gb|AES89034.1| Arginine decarboxylase [Medicago truncatula] Length = 526 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/42 (64%), Positives = 36/42 (85%) Frame = +1 Query: 1 PLLIPGEVMTEEATRYLVEVKNKGGFVSGASDPSLSSIVVCS 126 P+LIPGEV+TE+A YL+ V+++G +SGASDP LSSIVVC+ Sbjct: 484 PVLIPGEVITEKAVDYLLHVRSEGADISGASDPLLSSIVVCN 525 >ref|XP_003606835.1| Arginine decarboxylase [Medicago truncatula] gi|355507890|gb|AES89032.1| Arginine decarboxylase [Medicago truncatula] Length = 815 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/42 (64%), Positives = 36/42 (85%) Frame = +1 Query: 1 PLLIPGEVMTEEATRYLVEVKNKGGFVSGASDPSLSSIVVCS 126 P+LIPGEV+TE+A YL+ V+++G +SGASDP LSSIVVC+ Sbjct: 551 PVLIPGEVITEKAVDYLLHVRSEGADISGASDPLLSSIVVCN 592