BLASTX nr result
ID: Atractylodes22_contig00047923
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00047923 (265 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACY01928.1| hypothetical protein [Beta vulgaris] 55 5e-06 >gb|ACY01928.1| hypothetical protein [Beta vulgaris] Length = 1583 Score = 55.5 bits (132), Expect = 5e-06 Identities = 23/41 (56%), Positives = 35/41 (85%), Gaps = 1/41 (2%) Frame = -1 Query: 139 EIRRLSDAELQWRTQE-MCYHCDEKYSPGHRCKKKEVNVLV 20 EIRRLS+ ELQ++ + +C+ CDEK++ GHRCKKKE+++L+ Sbjct: 333 EIRRLSEKELQYKREHGLCFRCDEKWAIGHRCKKKELSILL 373