BLASTX nr result
ID: Atractylodes22_contig00047922
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00047922 (375 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001119115.1| uncharacerized protein [Arabidopsis thaliana... 67 2e-09 ref|XP_003544337.1| PREDICTED: uncharacterized protein LOC100799... 60 1e-07 ref|XP_003527682.1| PREDICTED: uncharacterized protein LOC100809... 56 3e-06 ref|XP_003603971.1| BZIP transcription factor ATB2 [Medicago tru... 55 5e-06 >ref|NP_001119115.1| uncharacerized protein [Arabidopsis thaliana] gi|332660996|gb|AEE86396.1| uncharacerized protein [Arabidopsis thaliana] Length = 42 Score = 67.0 bits (162), Expect = 2e-09 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = +1 Query: 247 ILSELFLSEFMINSTYWRRTHLVQSFSVVFLYWFYYIS 360 ILSE+FLS FM+NST RRTHLVQSFSVVFLYW YY+S Sbjct: 5 ILSEIFLSGFMLNSTIRRRTHLVQSFSVVFLYWLYYVS 42 >ref|XP_003544337.1| PREDICTED: uncharacterized protein LOC100799960 [Glycine max] gi|356564302|ref|XP_003550394.1| PREDICTED: uncharacterized protein LOC100799844 [Glycine max] Length = 41 Score = 60.5 bits (145), Expect = 1e-07 Identities = 29/40 (72%), Positives = 32/40 (80%) Frame = +1 Query: 241 SQILSELFLSEFMINSTYWRRTHLVQSFSVVFLYWFYYIS 360 S +LSE+ S FMINS+ RRTHLVQSFSVVFLYWFY S Sbjct: 2 SPVLSEILRSGFMINSSLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_003527682.1| PREDICTED: uncharacterized protein LOC100809564 [Glycine max] Length = 52 Score = 55.8 bits (133), Expect = 3e-06 Identities = 28/40 (70%), Positives = 33/40 (82%), Gaps = 3/40 (7%) Frame = +1 Query: 250 LSELFLSEF---MINSTYWRRTHLVQSFSVVFLYWFYYIS 360 ++E+ LSEF MINS++ RRTHLVQSFSVVFLYWFY S Sbjct: 1 MTEIPLSEFIRFMINSSFRRRTHLVQSFSVVFLYWFYVFS 40 >ref|XP_003603971.1| BZIP transcription factor ATB2 [Medicago truncatula] gi|355493019|gb|AES74222.1| BZIP transcription factor ATB2 [Medicago truncatula] Length = 209 Score = 55.5 bits (132), Expect = 5e-06 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = +1 Query: 244 QILSELFLSEFMINSTYWRRTHLVQSFSVVFLYWFYYI 357 QILSE+F S MINST RRTHLVQSFSVVFLY F+ + Sbjct: 3 QILSEIFFSGCMINSTVRRRTHLVQSFSVVFLYCFWVL 40