BLASTX nr result
ID: Atractylodes22_contig00047919
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00047919 (345 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003629173.1| Polynucleotidyl transferase [Medicago trunca... 57 1e-06 >ref|XP_003629173.1| Polynucleotidyl transferase [Medicago truncatula] gi|355523195|gb|AET03649.1| Polynucleotidyl transferase [Medicago truncatula] Length = 169 Score = 57.4 bits (137), Expect = 1e-06 Identities = 26/57 (45%), Positives = 36/57 (63%) Frame = -3 Query: 184 SMASLHPAVTVTNIRNFIPIVPEMDDGPYTSWVELFKIHCRAHDVIHHILPKEATTS 14 S HPA V+NI+N I IV EM+ Y +W ELF+I R+H V+HH +P + T+ Sbjct: 36 SKTKFHPAFAVSNIKNHIHIVLEMEKDQYGTWAELFRILARSHRVLHHGVPSKDNTT 92