BLASTX nr result
ID: Atractylodes22_contig00047491
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00047491 (611 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527052.1| conserved hypothetical protein [Ricinus comm... 65 1e-08 >ref|XP_002527052.1| conserved hypothetical protein [Ricinus communis] gi|223533614|gb|EEF35352.1| conserved hypothetical protein [Ricinus communis] Length = 170 Score = 64.7 bits (156), Expect = 1e-08 Identities = 37/119 (31%), Positives = 70/119 (58%), Gaps = 4/119 (3%) Frame = -1 Query: 473 SKDTTLYDPVLKYLHRFLAFSSSGHKDSAVVLSKIEFFFLWCMQGKKKVNLGCWLASQFA 294 +K T++ DP L++++R+ A++ DS ++ K E FF+ CMQ KV LG +LAS Sbjct: 20 AKSTSIIDPNLRHIYRWKAYTICARGDSFGIVQKTEVFFMHCMQKNIKVALGRFLASHLQ 79 Query: 293 SV--KGKQPLILGFLITQLAIHEHLFDPQSTSLHI--ACEMKPMDLSCLKVMGLIKEKD 129 S+ + + +++ L+T++A + +FDP+ + + + + ++L L M LIK+ D Sbjct: 80 SITTQPNENILIRSLVTKIATYLKVFDPKDITFKLLPQSDAEVLNLHTLVKMELIKKHD 138