BLASTX nr result
ID: Atractylodes22_contig00047434
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00047434 (328 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003540911.1| PREDICTED: uncharacterized protein LOC100813... 48 4e-06 >ref|XP_003540911.1| PREDICTED: uncharacterized protein LOC100813631 [Glycine max] Length = 1227 Score = 48.1 bits (113), Expect(2) = 4e-06 Identities = 24/53 (45%), Positives = 30/53 (56%) Frame = -3 Query: 164 WISIVPRKVNVFMWHLLNDGLPVKEKLYDRGIDM*SRLCPRCELQVESSDHCF 6 W VP KV F W LL D LP K+ L R I + + LCP C+ Q E++ H F Sbjct: 1063 WDLKVPPKVLSFAWRLLWDRLPTKDNLSRRQIQLDNDLCPLCQTQPETASHLF 1115 Score = 27.3 bits (59), Expect(2) = 4e-06 Identities = 13/40 (32%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = -2 Query: 267 KDGWSWTLDSKGLFSVKRLRELV--EEKLSNEWSNSVDLY 154 KD W W + G+FS K L+ E+ L +++S L+ Sbjct: 1024 KDTWLWGAEPNGIFSTKSAYNLIKAEQLLEDQYSGFHQLW 1063