BLASTX nr result
ID: Atractylodes22_contig00047359
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00047359 (394 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003630660.1| Chloroplast processing enzyme-like protein [... 57 2e-06 >ref|XP_003630660.1| Chloroplast processing enzyme-like protein [Medicago truncatula] gi|355524682|gb|AET05136.1| Chloroplast processing enzyme-like protein [Medicago truncatula] Length = 624 Score = 57.0 bits (136), Expect = 2e-06 Identities = 27/45 (60%), Positives = 34/45 (75%) Frame = +2 Query: 107 RLSVMVNMLVGKKAAIETKLGAYTRNFYGDSSSTDLETALQAMHI 241 R SV+++ML GK+A + TK+GAY R FYGD S +DLET LQA I Sbjct: 577 RPSVLMDMLAGKRAEVGTKIGAYMRTFYGDCSPSDLETGLQAASI 621